Working on this new server in php7...
imc indymedia

Los Angeles Indymedia : Activist News

white themeblack themered themetheme help
About Us Contact Us Calendar Publish RSS
Features
latest news
best of news
syndication
commentary


KILLRADIO

VozMob

ABCF LA

A-Infos Radio

Indymedia On Air

Dope-X-Resistance-LA List

LAAMN List




IMC Network:

Original Cities

www.indymedia.org africa: ambazonia canarias estrecho / madiaq kenya nigeria south africa canada: hamilton london, ontario maritimes montreal ontario ottawa quebec thunder bay vancouver victoria windsor winnipeg east asia: burma jakarta japan korea manila qc europe: abruzzo alacant andorra antwerpen armenia athens austria barcelona belarus belgium belgrade bristol brussels bulgaria calabria croatia cyprus emilia-romagna estrecho / madiaq euskal herria galiza germany grenoble hungary ireland istanbul italy la plana liege liguria lille linksunten lombardia london madrid malta marseille nantes napoli netherlands nice northern england norway oost-vlaanderen paris/Île-de-france patras piemonte poland portugal roma romania russia saint-petersburg scotland sverige switzerland thessaloniki torun toscana toulouse ukraine united kingdom valencia latin america: argentina bolivia chiapas chile chile sur cmi brasil colombia ecuador mexico peru puerto rico qollasuyu rosario santiago tijuana uruguay valparaiso venezuela venezuela oceania: adelaide aotearoa brisbane burma darwin jakarta manila melbourne perth qc sydney south asia: india mumbai united states: arizona arkansas asheville atlanta austin baltimore big muddy binghamton boston buffalo charlottesville chicago cleveland colorado columbus dc hawaii houston hudson mohawk kansas city la madison maine miami michigan milwaukee minneapolis/st. paul new hampshire new jersey new mexico new orleans north carolina north texas nyc oklahoma philadelphia pittsburgh portland richmond rochester rogue valley saint louis san diego san francisco san francisco bay area santa barbara santa cruz, ca sarasota seattle tampa bay tennessee urbana-champaign vermont western mass worcester west asia: armenia beirut israel palestine process: fbi/legal updates mailing lists process & imc docs tech volunteer projects: print radio satellite tv video regions: oceania united states topics: biotech

Surviving Cities

www.indymedia.org africa: canada: quebec east asia: japan europe: athens barcelona belgium bristol brussels cyprus germany grenoble ireland istanbul lille linksunten nantes netherlands norway portugal united kingdom latin america: argentina cmi brasil rosario oceania: aotearoa united states: austin big muddy binghamton boston chicago columbus la michigan nyc portland rochester saint louis san diego san francisco bay area santa cruz, ca tennessee urbana-champaign worcester west asia: palestine process: fbi/legal updates process & imc docs projects: radio satellite tv
printable version - js reader version - view hidden posts - tags and related articles

INFORMED DISSENT

by Tek Tuesday, Nov. 09, 2021 at 11:29 PM

the sars cov 2 virus does not exist : conclusive scientific, empirical and logical evidence for this pharmanazi scam

# INFORMED DISSENT :

THE CONVID COUP

by TEK



March 7, 2020 - November 10, 2021



There is no "covid" and fink laurence is its propheteer.



INDEX :

OUVERTURE p.2

CHAPTER 1 : NO DEATH SPIKES IN ITALY ! p.1

CHAPTER 2 : A CRIMINAL MASTERPLAN p.3

CHAPTER 3 : GLOBAL POLICE STATE p.4

CHAPTER 4 : VAXIS OF EVIL p.4

CHAPTER 5 : HUNTED DOWN SPIED ON TRANSHUMANIZED p.6

CHAPTER 6 : NO VIRUS NO DISEASE NO PANDEMIC p.7

CHAPTER 7 : TESTING THE TESTS p.11

CHAPTER 8 : ANTIBODY TESTING AND THERAPY, ANTIGEN

TESTS, LAMP TESTS : COMMERCIAL FRAUD p.45

CHAPTER 9 : THE VIRUS-SEQUENCING LIE p.50

CHAPTER 10 : SAY NO TO THIS VAXIS OF EVIL !!! p.57

CHAPTER 11 : ALPHABET SOUP p.80

CHAPTER 12 : (UN)TIMELY DEATHS p.87



OUVERTURE

One need not be a biochemist to grasp that this convid circus is nothing but a criminal pig pharm hoax for profit and renazification : just consider the Tokyo Olympics in progress as of July 30, 2021 : hundreds of athletes coming into contact on the field, unmasked, spitting and sweating and bleeding on each other in soccer volleyball rugby matches u name it : while Tokyo residents (vaxed and unvaxed alike, tested and untested alike !!!) are ludicrously being told by authorities to stay home and mask up because of the umpteenth fake convid surge !!! And don´t tell us that athletes are all tested monitored fully vaccinated because that is unverifiable. Hey pig pharmers : kiss my pass.

https://www.theguardian.com/world/live/2021/jul/30/coronavirus-live-news-philippines-locks-down-13-million-in-manila-japan-to-expand-state-of-emergency?page=with:block-610391a68f089093df86ea42#block-610391a68f089093df86ea42

" 5h ago 06:44

Japan to expand state of emergency

Japan is set to expand the coronavirus state of emergency in Tokyo to neighboring areas and the western city of Osaka on Friday in the wake of record-breaking surge in infections while the capital hosts the Olympics."

One need not be a scientist to collect immediate conclusive evidence that this whole convid circus is a scam : suffice to say that in my neckadawoods, you cannot board a fast train without a green pass - whereas you may board any local train !!! The latter being way more overcrowded than the former in that they are used daily by commuters, school kids etc. !! This is not about health at all.

CHAPTER 1 : NO DEATH SPIKES IN

ITALY !

MSM stated in May 2020 that there had been death spikes in Italy. There had not. It´s a huge lie spread by the national statistics center, directed by a fascist idiot and pig pharm puppet with no mathematical competence whatsoever.

https://www.corriere.it/cronache/20_maggio_04/rapporto-istat-8fd5bbb4-8e05-11ea-b08e-d2743999949b.shtml?refresh_ce-cp

https://www.epicentro.iss.it/coronavirus/pdf/Rapporto_Istat_ISS.pdf

Read please, the Nota metodologica towards the end :

1. normally it takes ISTAT 10 months after the end of any given year to come up with definitive statistical death data : this year for the first time in history, they have been allowed to spread death data in near-real time - a physical and mathematical impossibility.

2. Allowing for this miracle for a moment, which makes no sense because local county offices are extremely slow here in reporting definitive data, as families take ages to communicate a death to them, and they themselves take ages to process the data and send it to Rome ; but anyway : out of 7904 counties in total in Italy, ISTAT has arbitrarily chosen only 6866 for their extrapolations, ELIMINATING FROM THE COUNT AS MANY AS 1038 COUNTIES WHERE THERE HAD BEEN A DECREMENT IN DEATHS !!! THAT is how they came up with the OVERALL spikes - by way of fraud !!! And also the local spikes at this point are extremely dubiously arrived at.

3. They state clearly that their provisory data HAS NO STATISTICAL VALUE WHATSOEVER, pending further future elaboration and checks !

So do not fall into the trap of believing in data accuracy when in fact those alleged spikes are the same type of lie as with PCR tests etc., that we shall demonstrate below.

Updating this chapter on February 4, 2021, I do consider plausible that there have been death increases in Italy and worldwide in 2020/21 - but certainly not due to the nonexistent covid as we shall see, instead to the fact that many people with potentially lethal diseases postponed their treatments out of fear of catching "covid" in hospitals, resulting in their deaths. Not to mention the endless suicides of impoverished people who were forbidden from working by criminal governments, or died from hardship and stress. And from lethal therapies and intubations administered after false "covid" diagnoses based on fraudulent testing as we shall see. And from being isolated in hospitals without assistance from loved ones. And finally, from the so-called "covid vaccines".

Again : the dead passed off as "covid" deaths have been dying from 6 causes :

1. ordinary lethal pathologies such as interstitial pneumonia or severe flu complications, repackaged as the nonexistent covid on the basis of fraudulent testing ;

2. fear of going to hospital or treatment postponement for people suffering from lethal diseases such as cancer and cardiopathies needing constant hospital care ;

3. absurdly lethal therapies administered on the basis of fraudulent covid testing over things like a little fever or a cold : once misdiagnosed, these poor people have been given stuff such as intravenous interpheron, tocilizumab, intubation/ventilation - to which many fragile people, especially elderly, have succumbed

4. anxiety and panic from forced isolation/prohibition of visits/assistance from dear ones

5. suicides due to bankrupt forced on the poor by govts on pig pharm payroll - for instance, by shutting down small business for many months

6. the so-called "covid vaccines" that have massmurdered hundreds of thousands worldwide so far.

CHAPTER 2 : A CRIMINAL MASTERPLAN

https://off-guardian.org/2020/05/22/report-eu-planning-vaccination-passport-since-2018/

http:.//www.centerforhealthsecurity.org/event201/recommendations.html

https://futurism.com/neoscope/recent-simulation-coronavirus-killed-65-million-people

NOVEMBER 2019 : GATES GIVES A GOOD INVESTMENT TIP TO HIS COHORT RAY DALIO OF BRIDGEWATER FUND, WHO PROCEEDS TO MAKE A HUGE SHORT-TERM SPECULATIVE INVESTMENT BASED ON PREDICTING A STOCK EXCHANGE CRASH FOR MARCH 2020 - JUST WHAT WOULD REALLY HAPPEN THEN DUE TO THE FAKE "COVID" PANDEMIC :

http://www.lavocedellevoci.it/2020/03/16/pandemia-a-novembre-la-scommessa-da-1-miliardo-di-dollari-del-fondo-bridgewater/

https://en.wikipedia.org/wiki/Bridgewater_Associates

Remember how larry silverstein bought an insurance with lloyds covering terrorist attacks on his twin towers just before 911 ? Insider info it would appear.

Capitalfascism can only function through the spreading of fear and terror : until roughly 2001, they massmurdered their own, like 911 or the Bologna station massacre in 1980 ; starting with the Sandy Hook school shooting hoax back in 2012, they changed of tack and have started using their total control of the massmedia, to make humanity believe in false shooters, nonexistent islamist kamikazes, virtual neonazi attackers and the like - until now : the new fake enemy is a fake disease called "covid 19" (dress rehearsals for this new form of psyop had been "sars" and "mers" starting in 2003 - caused by alleged viruses whose very existence was every bit as questionable as that of "sars-cov-2", and that disappeared overnight just like they had appeared - in the msm alone).

Now I´ve been asked, y are airlines etc., pushing so hard for the jab ? Because they are owned by the very same globalist usurers who are selling it !! Here´s proof, let´s take American Airlines for one : https://www.marketscreener.com/quote/stock/AMERICAN-AIRLINES-GROUP-I-15171667/company/ Now scroll the link down to shareholders, and read the names of the main owners : vanguard group, blackrock, and the rest of them financial usurer thugs !!! Do u see now dear sisters and brothers, y everyone in the corporate and political sphere, is peddling that poison ? Nothing to do with health or this unproven, fictional virus !!!

CHAPTER 3 : GLOBAL POLICE STATE

" Police and public health officials to have powers to detain people who may be infected

Kate Proctor

Police, public health and immigration officers will be able to detain people suspected of having coronavirus under new emergency powers rolled out by the government.

The new guidance would allow the officials to return people to where they have been asked to stay during the virus outbreak, believed to be in a bid to curb people leaving hospital early. They will also have the power to take people to screening and testing facilities.

The bill says: “These measures look to fill existing gaps in powers to ensure the screening and isolation of people who may be infected or contaminated with the virus and to ensure that constables can enforce health protection measures where necessary.”

THIS AMOUNTS TO FULL GESTAPOIZATION OF SOCIETY - NOT EVEN HITLER WENT THIS FAR WITH HIS OWN CITIZENS !!!!!!:

https://www.theguardian.com/politics/live/2020/mar/19/uk-coronavirus-live-boris-johnson-london-lockdown-williamson-refuses-to-rule-out-government-putting-london-in-lockdown-by-weekend?page=with:block-5e735fb18f088d757559658f#block-5e735fb18f088d757559658f

CHAPTER 4 : VAXIS OF EVIL

How could pharma gangsters announce as early as of March 2020, they already had both drug and vaccine against "covid 19" at the ready ? It normally takes years to develop new drugs and vaccines against a new disease - no guaranteed achievement to boot. It is therefore mathematically certain that these same firms who are now claiming to have made drug and vaccine in 2 months, are those responsible for masterminding the "covid" hoax in the first place. They are going to sell governments snake oil - or worse, mandatory vax for all humanity. Some fear that, under the pretext of "covid", they are going to push a mandatory bar-code tattoo for all humanity. These vaxes they have been injecting into ignorant brainwashed masses for months now (as of Febr. 6, 2021) are experimental mRNA vaccines that manipulate our genomic functions : they contain synthetic, chemical messenger RNA with instructions for our DNA to produce the alleged spike protein of the alleged sars cov 2 virus : that is, they´ll coerce our bodies to first get sick in a sort of auto-immune way, only to then stimulate antibody reaction and immunitary memory - all of which over a nonexistent virus : they do not have it, nobody does, it´s never been isolated as we shall see below.

They haven´t even tried to come up with a traditional vax based on attenuated virus, because they do not have this nonexistent sars cov 2 virus !! Their real purposes are, on the one hand, to use humanity (bar themselves, the pig pharm owners and their political lackeys) as guinea pigs for a nazi experiment on how to turn us all into slavish GMOs ; on the other, to make trillions in de facto mandatory vaccines (they say the vax is voluntary only to keep up fake hypocritical democratic appearances, but if u don´t take the vax, be sure they are going to blacklist you as they ´ve done in spain, or fire you from your job, etc. : blackmail, de facto vax coercion). More on this below. DO NOT TAKE THIS JAB !!!!

What are these firms so apparently able to develop drugs and vaccines at the speed of light ?

The first one is Moderna :

https://www.corriere.it/economia/finanza/20_febbraio_25/coronavirus-vaccino-arrivo-usa-pronti-test-sull-uomo-f76b58b8-579d-11ea-a2d7-f1bec9902bd3.shtml?refresh_ce-cp

Now who are the owners of Moderna ? The usual suspects - the financial usurers who control the world : first up is fund vanguard, founded by the late christonazi usurer john bogle, but these days controlled by judeonazis fink laurence and kapito robert of blackrock:

https://money.cnn.com/quote/shareholders/shareholders.html?symb=AVD&subView=institutional

Next up is fidelity management, owned by the christonazi puritan dynasty of the johnsons, currently represented by johnson abigail ; third in line is blackrock itself, of judeonazis fink & kapito :

need I continue ? These criminals are the real spreaders !!! Of an utter hoax, that is - more proof will follow shortly.

The second lightning-speed drug maker is Gilead Sciences :

https://www.theguardian.com/world/2020/mar/10/hopes-rise-over-experimental-drugs-effectiveness-against-coronavirus

" Gilead stressed that it was boosting production [of anticovid drug remdesivir] “in anticipation of potential future needs” before knowing whether the trial would show the drug to be safe and effective at treating patients with the virus " :

NOW YOU TELL ME WHAT CAPITALIST CORPORATION WOULD BOOST PRODUCTION BEFORE RECEIVING SCIENTIFIC AND GOVERNMENTAL APPROVAL - RISKING TO LOSE BILLIONS ! THE ANSWER IS, GILEAD KNEW IN ADVANCE THAT REMDESIVIR WOULD BE TRUMPETED AS A SOLUTION TO THE FAKE PANDEMIC (AND THE OWNERS OF GILEAD SCIENCES ARE THE EXACT SAME AS THOSE FOR MODERNA : FINK & KAPITO OF BLACKROCK, THE JOHN BOGLE HEIRS, CAPITAL RESEARCH & MANAGEMENT OF CAPITALFASCIST LOVELACE DYNASTY CURRENTLY HEADED BY ROB LOVELACE, ETC. - BILDERBERG GALORE); "COVID" DOESN´T EVEN EXIST, AND THESE NEW DRUGS AND VACCINES ARE SNAKE OIL TO BE SOLD TO VASSAL GOVERNMENTS FOR A PROFIT, TO BE MADE MANDATORY AND INOCULATED INTO ALL HUMANS WITH DEVASTATING HEALTH AND IMMUNITY DAMAGE.

https://www.thewealthadvisor.com/article/19t-fund-giant-crazy-idea-about-investing

https://en.wikipedia.org/wiki/Jonathan_Bell_Lovelace

THESE DRUGS ARE EXTREMELY HEAVY IN SIDE EFFECTS, TO THE POINT OF LETHALITY FOR THE OLD WEAK AND IMMUNODEFICIENT : IT IS A CRIME AGAINST HUMANITY TO GIVE THEM TO PATIENTS IN THE NAME OF A FAKE VIRUS !!!!

As for Europe, the dominant vax player appears to be astrazeneca, owned by the usual global fund usurers :

https://www.corriere.it/salute/malattie_infettive/cards/guerra-vaccini-chi-vincera/sfida-senza-precedenti_principale.shtml

https://money.cnn.com/quote/shareholders/shareholders.html?symb=AZN&subView=institutional

REFUSE VACCINATION AGAINST A NONEXISTENT DISEASE !!!

A great youtube commentator posted this prophecy on Nov.13, 2020 :

PESTIL3NCE

" Not to worry mandatory vaccinations are coming, oh wait sorry. They ' re not going to be mandatory, you simply won´t be able to travel/fly, go to shops, dentist, or hospital without a vaccination certificate. Just the first of many mandatory vaccinations to come, don´t think it will happen? Guess you missed the health secretary talking about mandatory vaccinations & finding a way around the laws protecting the people´s right to choose. "

Another great yt commentator, 10.2.2021 :

Boba Fett

" Its far worse than that. Provisional approval granted on 27th Jan 2020 for AZ jab. Its on the official document front page. Virus hit China 17 dec 2019 , hit Victoria 25th Jan 2020 , TGA approved provisionally for the experimental continued clinical study as of 27th of January 2020. 2 days after the virus hits the state. That means the jab was around before the bug. " :

And I will only add to that, that the bug never existed at all.



CHAPTER 5 : HUNTED DOWN SPIED ON TRANSHUMANIZED

https://www.theguardian.com/world/2020/mar/17/israel-to-track-mobile-phones-of-suspected-coronavirus-cases

One of the real main purposes of this giant global hoax it is, to force us all to accept individual tracking via smartphone/apps of everybody´s every single movement and communication, under pretext of emergency legislation (unapproved by Parliaments that have been shut down)

to fight the non-existent pandemic. Plus mandatory facial recognition and sanitary treatments for all but those in power, and the rest of the orwellian panoplia - a capitalfascist´s wet dream of total control come true. And that´s just the beginning - with the same pretext, they are going to push for mandatory subcutaneous microchips for total remote control of all humanity - or even inoculate control chips into people´s bodies with mandatory vaccine shots - FIGHT BACK !!!

https://www.mintpressnews.com/mass-tracking-covi-pass-immunity-passports-slated-roll-15-countries/269006/

https://www.biometricupdate.com/201909/id2020-and-partners-launch-program-to-provide-digital-id-with-vaccines

Can you imagine for instance, forcibly applying the following technology to humans under the pretext of the next archfake ghost ?...:

https://www.theguardian.com/science/2021/sep/26/gene-editing-would-allow-us-to-create-hardier-farm-breeds

This is what awaits us too if we don´t stop this global IV reich asap :

https://www.theguardian.com/world/2021/oct/06/dystopian-world-singapore-patrol-robots-stoke-fears-of-surveillance-state

The rare judge worth his title these days :

https://www.theguardian.com/us-news/2021/sep/25/new-york-city-schools-teacher-covid-vaccine-mandate-federal-appeals-judge

CHAPTER 6 : NO VIRUS NO DISEASE NO PANDEMIC



https://www.nejm.org/doi/full/10.1056/NEJMoa2001017

Here´s what biochemist David Rasnik had to say in 2020 about the alleged "sars-cov-2" virus :

" The electron microscopy images of the new coronavirus I was talking about were published in the New England Journal of Medicine 2020. I accept that coronaviruses that cause the common cold exist. I am not convinced that a new coronavirus causing Covid-19 has been purified or even really exists. Given the importance of this you’d think the proof of existence would be easy to come by and be confirmed by independent labs around the world.

Zhu (2020) did TEM on cell culture supernatant (Fig. 3A), which looks very much like a coronavirus (see 100 nm reference bar, ideal for identification of the viral family, see attached file).

Fig. 3B shows particles inside a cell. This is the correct thing to do on primary lung tissue. (It’s not clear this was the case, however. See below.) They should have used the same magnification as in 3A in order to identify the particles as virus, in particular, coronavirus. Instead, they used 1µm (1000nm) reference bar.

[ My note : what Doctor Rasnick is saying here is, that these alleged pics of alleged isolated sars-cov-2 viruses look nowhere near the standard size that coronaviruses are supposed to feature :

https://www.clinicalmicrobiologyandinfection.com/article/S1198-743X(20)30363-3/fulltext

"The available viral genome sequences allowed to soon recognize the close relationship between SARS-CoV-2 and SARS-CoV-1, the causative pathogen of the 2002–2004 outbreak, presenting with severe acute respiratory syndrome (SARS).

Both viruses belong to the Coronaviridae family. They are characterized by a single-stranded 30 kb positive-sense RNA and enveloped spherical virions of about 160 nm. The unusual large size of their genome leaves these viruses enough space to rearrange their genes (recombination), thus donating them some genomic plasticity".

Now :

https://jkms.org/DOIx.php?id=10.3346/jkms.2020.35.e84

southkoreans allegedly isolate virus : from the pic scale we can see that the alleged, non-purified viruses are smaller than 100 nm (pic D) - the standard corona size being 160 !!!

Same scam in the zhou paper, the original chinese fakery that triggered the whole pandemy scam :

https://www.nejm.org/doi/full/10.1056/NEJMoa2001017

pic 3A : the 2 purportedly isolate viruses are way smaller than 160 nm !!! And the spikes are nowhere to be seen.]

Back to Doctor Rasnick :

" There are some things not quite clear in the paper. After close re-reading, It looks like the TEM photos, especially Fig. 3B, may not be of primary lung tissue from a patient.

On page 4 the authors say, "Virus isolation from clinical specimens was performed with airway epithelial cells and Vero E6 and Huh-7 cell lines.” This raises the question of a possible artifact, along the lines of Robert Gallo´s viral isolation of HIV. They should have first done TEM directly on primary lung tissue to establish the presence of virus. Culturing virus is fine but its presence must be confirmed by TEM of primary lung tissue.

It is essential to take great pains to accurately identify and characterize any presumed infectious agent present in people with new symptoms. That's where TEM on primary tissue samples from the person with symptoms is essential. This can be followed by culturing the suspect agent in order to purify it and performing TEM again, this time on the cultured virus. As a control, you must also perform TEM on the cultured cells that you have not treated with the suspect virus to make sure a virus had not contaminated the cells. I do not trust experiments using cancer cell lines to culture

virus. Usually, animals that are susceptible are treated with the pure virus to study and confirm its pathology.

Once all the preliminary work is done, which could take up to a year or more, simpler detection methods can be employed so long has their accuracy has been confirmed using gold standards such as TEM.

Look up Koch’s postulates. "

The chinese stated in their report that they had isolated the new virus now called sars-cov-2, termed by them 2019-nCoV, by combining (how?) 2 sequencing methods called Illumina and Nanopore, both of which are highly biased and error-prone :

https://www.nejm.org/doi/full/10.1056/NEJMoa2001017

https://en.wikipedia.org/wiki/Illumina_dye_sequencing

" This piecemeal process allows scientists to see the complete sequence even though an unfragmented sequence was never run; however, because Illumina read lengths are not very long (HiSeq sequencing can produce read lengths around 90 bp long), it can be a struggle to resolve short tandem repeat areas. Also, if the sequence is de novo and so a reference doesn't exist, repeated areas can cause a lot of difficulty in sequence assembly. Additional difficulties include base substitutions (especially at the 3' end of reads) by inaccurate polymerases, chimeric sequences, and PCR-bias, all of which can contribute to generating an incorrect sequence. "

https://en.wikipedia.org/wiki/Chimera_(molecular_biology)

"A chimera can also be an artifact of PCR amplification. It occurs when the extension of an amplicon is aborted, and the aborted product functions as a primer in the next PCR cycle. The aborted product anneals to the wrong template and continues to extend, thereby synthesizing a single sequence sourced from two different templates.

PCR chimeras are an important issue to take into account during metabarcoding, where DNA sequences from environmental samples are used to determine biodiversity. A chimera is a novel sequence that will most probably not match to any known organism. Hence, it might be interpreted as a new species thereby inflating over diversity." :

https://en.wikipedia.org/wiki/Nanopore_sequencing

" Notably, theorists have shown that sequencing via exonuclease enzymes as described here is not feasible.[14] This is mainly due to diffusion related effects imposing a limit on the capture probability of each nucleotide as it is cleaved. This results in a significant probability that a nucleotide is either not captured before it diffuses into the bulk or captured out of order, and therefore is not properly sequenced by the nanopore, leading to insertion and deletion errors. Therefore, major changes are needed to this method before it can be considered a viable strategy.

The use of proteins in biological nanopore sequencing systems, despite the various benefits, also brings with it some negative characteristics. The sensitivity of the proteins in these systems to local environmental stress has a large impact on the longevity of the units, overall. One example is that a motor protein may only unzip samples with sufficient speed at a certain pH range while not operating fast enough outside of the range- this constraint impacts the functionality of the whole sequencing unit. Another example is that a transmembrane porin may only operate reliably for a certain number of runs before it breaks down. Both of these examples would have to be controlled for in the design of any viable biological nanopore system- something that may be difficult to achieve while keeping the costs of such a technology as low and as competitive, to other systems, as possible.[9]

One challenge for the 'exonuclease approach',[32] where a processive enzyme feeds individual bases, in the correct order, into the nanopore, is to integrate the exonuclease and the nanopore detection systems. In particular,[33] the problem is that when an exonuclease hydrolyzes the phosphodiester bonds between nucleotides in DNA, the subsequently released nucleotide is not necessarily guaranteed to directly move into, say, a nearby alpha-hemolysin nanopore. One idea is to attach the exonuclease to the nanopore, perhaps through biotinylation to the beta barrel hemolysin. The central pore of the protein may be lined with charged residues arranged so that the positive and negative charges appear on opposite sides of the pore. However, this mechanism is primarily discriminatory and does not constitute a mechanism to guide nucleotides down some particular path. "

https://en.wikipedia.org/wiki/De_novo_sequence_assemblers

" Reads from second generation technologies (called short read technologies) like Illumina are typically short (with lengths of the order of 50-200 base pairs) and have error rates of around 0.5-2%, with the errors chiefly being substitution errors. However, reads from third generation technologies like PacBio and fourth generation technologies like Oxford Nanopore (called long read technologies) are longer with read lengths typically in the thousands or tens of thousands and have much higher error rates of around 10-20% with errors being chiefly insertions and deletions."

THEY HAVE NEVER ISOLATED THE "VIRUS"! As reported by FDA/CDC: FDA - U.S. Food and Drug Administration ; CDC - Centers for Disease Control and Prevention Division of Viral Diseases, Revision: 07, effective: 07/21/2021:

"SINCE NO QUANTIFIED VIRUS ISOLATES OF THE 2019-nCoV were available for CDC use at the time the test was developed..."

page 40 (2nd paragraph) on this link :

https://www.fda.gov/media/134922/download



Here´s how the alleged sequencing of sars cov 2 is described in the zhu paper :

" Viral Genome Sequencing

RNA extracted from bronchoalveolar-lavage fluid and culture supernatants was used as a template to clone and sequence the genome. We used a combination of Illumina sequencing and nanopore sequencing to characterize the virus genome. Sequence reads were assembled into contig maps (a set of overlapping DNA segments) with the use of CLC Genomics software, version 4.6.1 (CLC Bio). Specific primers were subsequently designed for PCR, and 5′- or 3′-RACE (rapid amplification of cDNA ends) was used to fill genome gaps from conventional Sanger sequencing. These PCR products were purified from gels and sequenced with a BigDye Terminator v3.1 Cycle Sequencing Kit and a 3130XL Genetic Analyzer, in accordance with the manufacturers’ instructions." :

now : CLC Genomics warns on its own package insert, that it should never be used for diagnostics, only for research purposes !!! :

http://pages.ingenuity.com/rs/202-RSH-885/images/build-manual-plugin-MGM.pdf

p.2.

And : since PCR amplificates only a tiny segment of a genome and never an entire genome, the reconstruction and filling of genome gaps to obtain an entire genome was clearly, totally arbitrary and based on subjective and biased algorithms not on natural/visual observation of a complete viral genome which neither the chinese nor anyone else has been able to properly isolate that is purify so far.

More highlights from the zhu paper :

https://www.nature.com/articles/s41586-020-2012-7

"The association between 2019-nCoV and the disease has not been verified by animal experiments to fulfil the [sic!] Koch’s postulates to establish a causative relationship between a microorganism and a disease."

"No statistical methods were used to predetermine sample size. The experiments were not randomized and the investigators were not blinded to allocation during experiments and outcome assessment."

The german counterparts of these chinese swindlers are no less subservient to bill gates and big pharma, substituting swindle for real science :

https://www.corriere.it/esteri/20_giugno_01/coronavirus-germania-virologo-star-bufera-l-accusa-stampa-asservito-politica-5e3bb63a-a403-11ea-b19d-c124828d4b5b.shtml

https://www.bild.de/politik/inland/politik-inland/fragwuerdige-methoden-drosten-studie-ueber-ansteckende-kinder-grob-falsch-70862170.bild.html



THERE IS NO SARS-COV-2 VIRUS THERE IS NO COVID 19 DISEASE THERE IS NO EPIDEMIC THERE IS NO PANDEMIC IT´S ALL ONE PHARMANAZI HOAX FOR PROFIT MASTERMINDED BY CRIMINALS AGAINST HUMANITY BILL GATES, LAURENCE FINK, ROBERT KAPITO, RAY DALIO AND THE REST OF THEM BILDERBERG THUGS DO NOT GET TESTED FOR COVID DO NOT WEAR MASKS REFUSE TO BE VACCINATED AGAINST A NONEXISTENT VIRUS DO NOT DOWNLOAD TRACING APPS SPREAD TRUE SCIENCE AND FIGHT BACK !!!!!!!!!!!!

https://wissenschafftplus.de/uploads/article/wissenschafftplus-fehldeutung-virus-teil-2.pdf

https://www.youtube.com/watch?v=xFwqArvB1IM

https://la.indymedia.org/news/2020/05/299352.php

http://theinfectiousmyth.com/coronavirus/AntibodyTestingForCOVID.pdf https://twitter.com/DavidRCrowe

https://www.youtube.com/watch?v=NYr2jJf-zZ0&t=187s https://www.youtube.com/watch?v=oWBRNwoUqFY&t=8s https://blog.nomorefakenews.com/2018/04/04/the-gold-standard-of-medical-tests-is-fake/

https://theinfectiousmyth.com/book/CoronavirusPanic.pdf

https://twitter.com/DavidRCrowe https://theinfectiousmyth.com/coronavirus/EvidenceExistenceCOVID19Corbett.pdf

https://theinfectiousmyth.com/coronavirus/RT-PCR_Test_Issues.php

https://lockdownsceptics.org/the-incredible-and-scary-truth-about-covid-19-tests-2/

https://twitter.com/InfectiousMyth/status/1250138967799779328

https://www.projectveritas.com/

https://www.youtube.com/watch?v=o7A_cMpKm6w&t=5s https://www.youtube.com/watch?v=yaOvva72b7o

https://uncoverdc.com/2020/04/07/was-the-covid-19-test-meant-to-detect-a-virus/ https://www.youtube.com/watch?v=xFwqArvB1IM

https://www.corriere.it/esteri/20_giugno_01/coronavirus-germania-virologo-star-bufera-l-accusa-stampa-asservito-politica-5e3bb63a-a403-11ea-b19d-c124828d4b5b.shtml

https://drive.google.com/file/d/1S7xW72ahs7Guqo7JzzPFuI0P6wjg_j5r/view



CHAPTER 7 : TESTING THE TESTS



PCR TESTING IS NOT INTENDED FOR DIAGNOSTIC USE, AS BIG PHARMA ROCHE MANUFACTURER ITSELF STATES :

" The LightCycler® 480 Instrument is

not intended for use in diagnostic procedures. " :

http://icob.sinica.edu.tw/pubweb/bio-chem/Core%20Facilities/Data/R401-core/LightCycler480%20II_Manual_V1.5.pdf

p.11.

AND YET ON SUCH NONDIAGNOSING TESTING, THE WHOLE DIAGNOSIS CIRCUS AND INFECTED-COUNT IS BEING BASED !!!!!!!!!!!!!!!!

IT´S A TOTAL FRAUD !!!!!!!!!!!!!!

See for instance this ludicrous pseudoscientific report claiming to have detected sars-cov-2 in tears, by using lightcycler 480 :

https://onlinelibrary.wiley.com/doi/full/10.1002/jmv.25725

"ran the PCR reaction using the Roche LightCycler® 480 (Roche Diagnostics GmbH, Mannheim, Germany). After instantaneous centrifugation for 40 cycles, the PCR was completed in about 85 minutes; thereafter, we checked the amplification curves to judge whether the results were negative or positive." : 40 cycles for PCR is ludicrously too many : a strong viral load only takes a max of 30 cycles for detection - anything above that threshold, would at best signal an irrelevantly poor viral presence.

The pseudoscientists in this pseudostudy admitted to not having isolated the virus in tears, so just what are they ranting about ? :

" However, the virus was not successfully isolated and cultured in the conjunctival secretion of the patient." !!

An italian team after this, claimed to have isolated the virus and cultured it, but without performing electron microscopy on it, so how did they know what TYPE of virus it was in those tears ?

https://www.acpjournals.org/doi/10.7326/M20-1176

Again they relied on PCR - unsuited for diagnostic purposes as roche manufacturer itself clearly states. Furthermore, the italians cultured the alleged virus using vero cells and not primary lung tissue from patien biopsy, so let us remind them what it is to do science in David Rasnick´s wording again :

"Virus isolation from clinical specimens was performed with airway epithelial cells and Vero E6 and Huh-7 cell lines. This raises the question of a possible artifact, along the lines of Robert Gallo´s viral isolation of HIV. They should have first done TEM directly on primary lung tissue to establish the presence of virus. Culturing virus is fine but its presence must be confirmed by TEM of primary lung tissue.

It is essential to take great pains to accurately identify and characterize any presumed infectious agent present in people with new symptoms. That's where TEM on primary tissue samples from the person with symptoms is essential. This can be followed by culturing the suspect agent in order to purify it and performing TEM again, this time on the cultured virus. As a control, you must also perform TEM on the cultured cells that you have not treated with the suspect virus to make sure a virus had not contaminated the cells. I do not trust experiments using cancer cell lines to culture

virus. Usually, animals that are susceptible are treated with the pure virus to study and confirm its pathology.

Once all the preliminary work is done, which could take up to a year or more, simpler detection methods can be employed so long has their accuracy has been confirmed using gold standards such as TEM.

Look up Koch’s postulates. "

Next we examine a southkorean report claiming to have isolated sars cov 2 and performed TEM on cells inoculated with it :

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7045880/

They show TEM pics purported to detect coronavirus-like morphology : but how do they know the pics are of this alleged new virus and not of another X corona ? How can we be sure what those black dots are ? And then again, the southkoreans based their diagnosis on PCR - a test unsuited for diagnostic purposes ! And they sequenced the alleged full genome of this alleged new coronavirus, by using the miseq illumina system which states in its package insert :

"Solo a uso di ricerca. Non usare in procedimenti diagnostici."

" For research purposes alone. Do not use in diagnostic procedures." !!!

https://www.illumina.com/content/dam/illumina-marketing/documents/products/datasheets/miseq-data-sheet-770-2011-001-translations/miseq-specification-sheet-770-2011-001-ita.pdf

https://uncoverdc.com/2020/04/07/was-the-covid-19-test-meant-to-detect-a-virus/

" Dr. Mullis wrote, on May 7, 2013: “PCR detects a very small segment of the nucleic acid which is part of a virus itself. The specific fragment detected is determined by the somewhat arbitrary choice of DNA primers used which become the ends of the amplified fragment. “

No, there is no such thing as a special test for the alleged "covid 19". Covid 19 is the official name they gave this alleged disease. The name for the virus is sars-cov-2. Now, if a virus is inside your body, it does NOT necessarily imply that you are sick. Just that you are "positive" to that particular virus. So : you might be sars-cov-2- positive, but still not have the disease covid 19 : not be sick.

Ok ? This is a very important difference, never forget it . Now : nobody has given us any solid evidence that this alleged new type of coronavirus, sars-cov-2, really exists. And there is no evidence that, IF it exists, it is the cause of the alleged disease called covid 19. What you hear from the massmedia is only lies : in the world of true science, it takes over a year to confirm the existence of a new virus, and its pathogenicity, that is to say, the fact that it does cause a new disease.

Now : there are 3 main types of tests that are (falsely) believed to detect a virus in your body : the first test is called RT-PCR, or just simply PCR ; the second test is called serological, as it analyzes the serum (a part of your blood) in search of antibodies revealing that you have been exposed to a virus in the recnt past (it takes weeks for antibodies to develop and become detectable). The third is the antigen test, which is the opposite of the antibody test : it exposes your blood to alleged viral antibodies to detect the relative antigen (that is, viral protein) in your blood.

These tests are NOT specific to any particular virus, though they might claim otherwise. Let me give you 2 examples from commercially available PCR tests being used these days , I shall quote from the company package inserts that come with these tests : - Abbott : "Positive results do not rule out bacterial infection or co-infection with other viruses...Due to the high sensitivity of the assays run on the instrument, contamination of the work area with previous positive samples may cause false positive results" ; - Accula : " Cross-reactivity with respiratory tract organisms other than those listed in the Analytical Specificity Study may lead to erroneous results…" : what they are saying is : we cannot guarantee through our test that you are positive to sars-cov-2 because our test may confuse sars-cov-2 with just about anything else, any other kind of RNA in your cells or other things !!!

It´s a hoax, it´s a swindle, it is global pharma nazism to terrorize us all into buying their useless and harmful vaccines and drugs and face masks and disinfectants that will only cause one allergies and poisonings, and accept total control of our lives, contact tracing etc., under the false pretext of a pandemic that does NOT exist.

https://uncoverdc.com/2020/04/07/was-the-covid-19-test-meant-to-detect-a-virus/

" Dr. Mullis wrote, on May 7, 2013:“PCR detects a very small segment of the nucleic acid which is part of a virus itself. The specific fragment detected is determined by the somewhat arbitrary choice of DNA primers used which become the ends of the amplified fragment. “

PCR testing for the alleged sars-cov-2 virus is fraudulent : here is evidence taken directly from genesig company´s RT-PCR package insert :

" Interpretation of results must account for the possibility of false negative and false positive results.

• False negative results may be caused by:

o Unsuitable collection, handling and/or storage of samples.

o Sample outside of viraemic phase.

o Failure to follow procedures in this handbook.

o Use of unauthorised extraction kit or PCR platform.

• False positive results may be caused by:

o Unsuitable handling of samples containing high concentration of SARS-CoV-2 viral RNA or positive control template.

o Unsuitable handling of amplified product.

• All results should be interpreted by a health care professional in the context of patient medical history and clinical symptoms.

• This test cannot rule out diseases caused by other pathogens.

• A negative result for any PCR test does not conclusively rule out the possibility of infection. " :

https://www.genesig.com/assets/files/Path_COVID_19_CE_IVD_IFU_Issue_3.pdf?timestamp=1589212981

p.8

DO NOT TAKE THIS TEST, PCR IS NOT A DIAGNOSTIC TOOL !!!

https://en.wikipedia.org/wiki/Hybridization_probe

"Detection of sequences with moderate or high similarity depends on how stringent the hybridization conditions were applied—high stringency, such as high hybridization temperature and low salt in hybridization buffers, permits only hybridization between nucleic acid sequences that are highly similar, whereas low stringency, such as lower temperature and high salt, allows hybridization when the sequences are less similar."

https://www.future-science.com/doi/abs/10.2144/01315dd03

https://www.gene-quantification.de/SIAL-qPCR-Technical-Guide.pdf

Now highly similar is NOT identical : and since the genome of other known coronaviruses such as especially NL63 causing some 15% of the common cold is highly similar to the alleged, artificially made up genome of this purported "sars-cov-2", a PCR test at best risks branding you positive to covid when in fact all you have is a cold or some other respiratory infection caused by other known coronas. And since stringency parametres can be set at will, the window for outright fraud here is a gaping hole !!!!!!!!

DO NOT SUBMIT TO COVID TESTING !!!!!!!!!!!

PCR is unreliable when it comes to covid testing : more evidence from the package inserts of some PCR test kits in use :

- Abbott RealTime SARS-CoV-2 : The impacts of vaccines, antiviral therapeutics, antibiotics, chemotherapeutic or immunosuppressant drugs [on the performance of this test] have not been evaluated… Due to the high sensitivity of the assays run on the instrument, contamination of the work area with previous positive samples may cause false positive results.

- Accula Test for SARS-CoV-2 : Detection of SARS-CoV-2 RNA may be affected by sample collection methods, patient factors (e.g., presence of symptoms), and/or stage of infection… Cross-reactivity with respiratory tract organisms other than those listed in the Analytical Specificity Study may lead to erroneous results… Analyte targets (viral nucleic acid) may persist in vivo, independent of virus viability… contamination of the work area with previous samples may cause false positive results.

Forget about PCR for covid diagnostics : it is fraud.

Ask yourselves whether or not this alleged disease exists at all to begin with.

https://en.wikipedia.org/wiki/Hybridization_probe

https://www.future-science.com/doi/abs/10.2144/01315dd03

https://www.future-science.com/doi/pdf/10.2144/01315dd03

https://www.gene-quantification.de/SIAL-qPCR-Technical-Guide.pdf

Simply put : if they perform qPCR testing by the probe method, they can easily skew it to make you test positive to any corona other than the alleged sars-cov-2.

If they perform qPCR on you by the dye method - the most commonly used as it´s way cheaper - then they won´t be able to tell a virus from another or from any type of nonviral RNA, because dye-based qPCR is NONspecific. qPCR = quantitative PCR :

" Two common methods for the detection of PCR products in real-time PCR are (1) non-specific fluorescent dyes that intercalate with any double-stranded DNA and (2) sequence-specific DNA probes consisting of oligonucleotides that are labelled with a fluorescent reporter, which permits detection only after hybridization of the probe with its complementary sequence. " :

https://en.wikipedia.org/wiki/Real-time_polymerase_chain_reaction

Briefly : PCR testing for covid is a fraud - DO NOT DO IT !!!

https://onlinelibrary.wiley.com/doi/10.1111/tbed.13684

https://www.cebm.net/covid-19/infectious-positive-pcr-test-result-covid-19/

https://www.cebm.net/evidence-synthesis/transmission-dynamics-of-covid-19/

https://www.spectator.co.uk/article/what-does-a-case-of-covid-19-really-mean-

https://www.cebm.net/covid-19/when-is-covid-covid/



Next is a protocol for primer design targeting 4 genes of the alleged sars-cov-2 virus :

" the selection of primer sets for target genes (RdRP, N, E, and S) in the genome of interest (SARS-CoV-2)" :

"The first step is to select the target genes (RdRP, N, E, and S) to be detected in the genome of interest (SARS-CoV-2) and design a primer based on the target sequence of each gene."

"Step 1: target genes were selected from genomic databases, and primers were designed using Primer3" :

how do they know databases are reliable ?

"Our primer sets were designed specifically for SARS-CoV-2 so that they did not target other human coronaviruses, such as human coronavirus OC43 (HCoV-OC43), human coronavirus NL63 (HCoV-NL63), human coronavirus HKU1 (HCoV-HKU1), and human coronavirus 229E (HCoV-229E)." :

how did u achieve that, since u targeted nonspecific proteins common to all coronas ?

https://www.nature.com/articles/s12276-020-0452-7

Now : none of those 4 genes are unique to the alleged sars cov 2 : they are common to all coronas :

https://en.wikipedia.org/wiki/Coronavirus

RdRP (replicase-transcriptase), S protein (spike), E protein (envelope), N protein (nucleocapsid).

Do those 4 common genes to all coronas allegedly occur in different sequences or quantities for the alleged sars cov 2 ? (The PCR protocol article states for instance, that E is low for sars, I suppose as opposed to other coronas´s levels).

They may be meaning the quantity of structural proteins : the following article states that S is much more present in sars cov 2 as opposed to sars cov 1 and mers - two highly conjectural viruses themselves ! And that E is in much lower expression again against the other 2 :

https://www.biorxiv.org/content/10.1101/2020.04.16.043224v1.full

But the study did not perform its own analysis of live samples - again resorting to databanks.

And for the alleged sars1 and mers samples there were no human samples, only murine !!!

Therefore, the study did not even bother to doublecheck whether or not, in the real world, this alleged sars-cov-2 viral genome in the databank exist or not !!! Acting on blind faith - a mockery of science : such studies are worthless garbage.

So where is a comparison between sars cov 2 and the 4 known coronas ?

Further : the above "study" only could compare subgenomic sgRNA - structural proteins being by implication identical.

I find nowhere, how the alleged sars cov 2 compares to the known 4 :

1. 229E (alpha coronavirus)

2. NL63 (alpha coronavirus)

3. OC43 (beta coronavirus)

4. HKU1 (beta coronavirus)

Here is a better study, but again based on the zhou paper not on direct isolation/microscopy, detailing the alleged differences against other sarses but not the 4 - the only time it mentions one of the 4, it is to say that the second allegedly unique feature of sars cov 2 is really common with HKU1 ! :

" 2. Polybasic furin cleavage site and O-linked glycans

The second notable feature of SARS-CoV-2 is a polybasic cleavage site (RRAR) at the junction of S1 and S2, the two subunits of the spike. This allows effective cleavage by furin and other proteases and has a role in determining viral infectivity and host range. In addition, a leading proline is also inserted at this site in SARS-CoV-2; thus, the inserted sequence is PRRA. The turn created by the proline is predicted to result in the addition of O-linked glycans to S673, T678 and S686, which flank the cleavage site and are unique to SARS-CoV-2 . Polybasic cleavage sites have not been observed in related ‘lineage B’ betacoronaviruses, although other human betacoronaviruses, including HKU1 (lineage A), have those sites and predicted O-linked glycans."

Again one can see very well here, that whatever structural protein a PCR targets, it is going to be common with the 4 :

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7395230/figure/f0015/?report=objectonly

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7395230/

except for the presence of some different ORFs - but if your primers bind to the proteins alone, it is the same proteins in the same sequence, so how is crossreactivity avoided with certainty ?

In fact, according to the PCR package inserts collected by Crowe, it NEVER is !!!



Table 2

Percent identity of novel coronavirus SARS-CoV2 strain with different CoV strains. (Chan et al., 2020; Chen et al., 2020; Gralinski and Menachery, 2020; Malik et al., 2020; Ren et al., 2020; Zaki et al., 2012; P. Zhou et al., 2020a).

S•No Viral strains Genus Percent identity

1 HCoV-229E α 65.04

2 HCoV-NL63 α 65.11

3 HCoV-HKU1 β 67.59

4 HCoV-OC43 β 68.93



Table 4

Percent identity matrix of major proteins and domains of novel coronavirus SARS-CoV2 strain with other beta-CoVs obtained using CLUSTAL O (1.2.4). [my note : clustal omega has scored worst in studies, in terms of its accuracy !!!]

PROTEIN SARS-CoV MERS-CoV HCoV HKU1 HCoV OC43

S (spike) 97.71% 32.79% 30.50% 31.26%

E (Envelope) 96.00% 36.00% 28.00% 20.00%

M (Membrane) 89.59% 39.27% 35.29% 38.74%

N (Nucleocapsid) 85.41% 48.47% 34.28% 35.20%

Receptor (ACE-2) binding domain 74.41% 18.75% 24.44% 22.83%

N-terminal domain 52.55% 21.67% 21.49% 20.26%

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7395230/figure/f0035/?report=objectonly

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7395230/

All of which would appear to suggest that there are indeed big genomic sequencing differences at least between sars2 and two of the 4 : but again, this is referring to a database genome of highly dubious origin (zhou). And even if all these differences were accurate, there´s enough union set to warrant for possible crossreactivity in the PCR test.

Further : why wasn´t the genomic comparison extended to cover 229E (alpha coronavirus) and NL63 (alpha coronavirus) ?



https://www.sciencedirect.com/science/article/pii/S1386653220301165?via%3Dihub

Putting it simply : if you have or have just had a common cold, and get tested, you risk being branded positive to the nonexistent "sars-cov-2" virus - with all the forced consequences that the pharmanazis in power are oppressing us with : quarantene, isolation, more intrusive and dangerous swabs, heavy drugs etc. :

https://www.thelancet.com/journals/lanres/article/PIIS2213-2600(20)30453-7/fulltext

" Potential consequences of false-positive COVID-19 swab test results

Individual perspective

Health-related



For swab tests taken for screening purposes before elective procedures or surgeries: unnecessary treatment cancellation or postponement



For swab tests taken for screening purposes during urgent hospital admissions: potential exposure to infection following a wrong pathway in hospital settings as an in-patient

Financial



Financial losses related to self-isolation, income losses, and cancelled travel, among other factors

Psychological



Psychological damage due to misdiagnosis or fear of infecting others, isolation, or stigmatisation

Global perspective

Financial



Misspent funding (often originating from taxpayers) and human resources for test and trace



Unnecessary testing



Funding replacements in the workplace



Various business losses

Epidemiological and diagnostic performance



Overestimating COVID-19 incidence and the extent of asymptomatic infection



Misleading diagnostic performance, potentially leading to mistaken purchasing or investment decisions if a new test shows high performance by identification of negative reference samples as positive (ie, is it a false positive or does the test show higher sensitivity than the other comparator tests used to establish the negativity of the test sample?)

Societal



Misdirection of policies regarding lockdowns and school closures



Increased depression and domestic violence (eg, due to lockdown, isolation, and loss of earnings after a positive test).

Technical problems including contamination during sampling (eg, a swab accidentally touches a contaminated glove or surface), contamination by PCR amplicons, contamination of reagents, sample cross-contamination, and cross-reactions with other viruses or genetic material could also be responsible for false-positive results.

These problems are not only theoretical; the US Center for Disease Control and Prevention had to withdraw testing kits in March, 2020, when they were shown to have a high rate of false-positives due to reagent contamination. "

https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/895843/S0519_Impact_of_false_positives_and_negatives.pdf

" It is important to remember that laboratory testing verifies the analytical sensitivity and analytical specificity of the RT-PCR tests. They represent idealised testing. In a clinical or community setting there may be inefficient sampling, lab contamination, sample degradation or other sources of error that will lead to increased numbers of false positives or false negatives. The diagnostic sensitivity and diagnostic specificity of a test can only be measured in operational conditions."

" What causes false positives?

•Cross reactions with other genetic material. Other sources of DNA or RNA may have cross reactive genetic material that can be amplified by the RT-PCR test. False positives were observed unexpectedly in norovirus assays in patients with enterocolitis, due to unusually high levels of human DNA in samples

•Contamination during sampling. This may happen if the swab head accidently contacts, or is placed on a contaminated surface (e.g. latex gloves, hospital surface).

•Contamination during swab extraction. Viral RNA is extracted from swabs in solution; accidental aerosolization of liquid can cause cross contamination between samples.

•Contamination with PCR amplicon. The PCR amplification process generates millions of copies of the DNA target (amplicon) that can cause false positives in subsequent PCR reactions. If a testing lab is accidently contaminated with amplicon it can lead to sporadic false positives.

•Contamination of PCR laboratory consumables. Contamination can spread from a post-PCR lab into a pre-PCR lab by transfer of equipment, chemicals, people or aerosol. Even experienced national labs can be affected. In early-March 2020, COVID-19 RT-PCR assays produced by the CDC were withdrawn after many showed false positives due to contaminated reagents."

" Why are false positives a problem?

DHSC figures show that 100,664 tests were carried out on 31 May 2020 (Pillar 1 and 2 RT-PCR tests). 1,570 of those tests were positive for SARS-CoV-2 (1.6%). The majority of people tested on that day did not have SARS-CoV-2 (98.4% of tests are negative). When only a small proportion of people being tested have the virus, the operational false positive rate becomes very important. Clearly the false positive rate cannot exceed 1.6% on that day, and is likely to be much lower. If the operational false positive rate was 0.4%, 400 of the 1,570 positive tests would be false positives. That would represent 400 people being isolated when they are well, and much wasted effort in contact tracing. It is possible that a proportion of infections that we currently view as asymptomatic may in fact be due to these false positives.Unless we understand the operational false positive rate of the UK’s RT-PCR testing system we risk overestimating the COVID-19 incidence, the demand on track and trace, and the extent of asymptomatic infection."

https://www.regenhealthsolutions.info/2020/04/30/in-covid-19-recovered-patients-south-korean-kcdc-experts-found-false-positives-not-reinfections/

" He went on to explain that in PCR tests, or polymerase chain reaction tests, used for COVID-19 diagnosis, genetic materials of the virus amplify during testing, whether it is from a live virus or just from fragments of dead virus cells that can take months to clear from recovered patients.

The PCR tests cannot distinguish whether the virus is alive or dead, he added, and this can lead to false positives."

Furthermore, before PCR, possible viral material in the sample gets inactivated by using buffer solutions for biosafety´s sake - therefore, at the end of the test, how can we be certain that whatever virus was amplified, had been active and thus infective to begin with ?

https://www.nationalheraldindia.com/opinion/positive-negative-positive-how-reliable-are-covid-19-tests

"A test needs to be tested against a gold standard. In case of an infectious disease, the gold standard remains the demonstration of the microorganism (bacteria, virus or parasite as the case may be).

In case of RT PCR for COVID-19 the virus has so far not been demonstrated. How have we then relied so heavily on a test that has no validation of its reliability?

Over a century ago Robert Koch postulated that in a microbial infection the microbe must be present in every case of the disease. Microbe must be isolated from the patient with the disease and grown in pure culture. The specific disease must be reproduced when a pure culture of the microbe is inoculated into a healthy susceptible host.

With certain modifications these postulates have been the basis of defining a microbial disease and have so far withstood the test of time. In the present pandemic, with half a million deaths over six months, the disease is yet to pass muster."

https://virologydownunder.com/pcr-primers-a-primer/

" While that all sounds very convincing, in reality, primers designed to detect viruses often share significant amounts of homology with the human genome – sometimes resulting in false-positive amplification. Even when the homology is far from 100%, primers may still amplify an unintended target as shown below. This most likely reflects the co-evolution of many viruses with humans during which time they have “captured” bits of our genome and “deposited” bits of their own genome.

Mispriming occurs because of poorly optimised conditions or because we haven’t checked whether our sequence will inadvertently bind to an entirely different target entity e.g. a region of the human genome instead of the intended virus genome. Sometimes it just happens.

Mispriming can usually be avoided by more intensive comparison of the primer’s sequence against the GenBank database using the Basic Local Alignment Search Tool (BLAST) at NCBI. Of course, a BLAST comparison will only find matches among those sequences housed in the database. When it comes to PCR where a single nucleotide mismatch can cause amplification to fail, or at least perform with reduced efficiency, BLAST’ing primers can lead to a feeling of very false security.

In some instances, the homology of the PCR primers to their template may indicate a perfect match simply because viral variants have not yet been sequenced and submitted. Also, because there may be many undiscovered viruses and unsequenced non-viral genomes in the world, obviously none of which are represented on GenBank, a specific match, or a “no match”, does not mean that you have exhausted your search for homologues. Take it all with a grain of salt. Designing two pairs of primers around the target region is a good place to start. This helps address the unexpected.

Some early RT-rPCR tests were designed intentionally to allow for sequence variation just in case the virus did a lot of changing early on (it didn’t). "



DO NOT GET TESTED FOR THE NONEXISTENT "SARS-COV-2" VIRUS OR THE NONEXISTENT "COVID" DISEASE !!!!!!!!!!!!!!!!!

Ask yourselves the following questions :

- does the alleged sars-cov-2 virus really exist ?

- if so, what precisely is the scientific evidence for its existence ?

- since primers and probes used in PCR covid-testing are based on databank sequences, are test results dependent on whether or not those databank sequences for sars cov 2 are real and truthful, or wrong or fake ?

- why hasn´t anyone so far, control-tested a sample declared positive to "covid", for all of the 4 coronaviruses known to cause 15% of common colds and other respiratory diseases - only way to ascertain possible crossreactivity ?

- and : what if a sample, deemed positive to sars-cov-2, had contained other virus types as well ? How to ascertain, which of the virus types in a given sample is the pathogen for the symptomatic person sampled ?

https://www.centerforhealthsecurity.org/resources/COVID-19/COVID-19-fact-sheets/200410-RT-PCR.pdf

" Ideally, cross-reactivity should be tested on RNA derived from patient samples. To be deemed adequately specific, the test should not read positive for any virus other than SARS-CoV-2."

Ideally ??? Why don´t you ever check it !!!!!!!!!!!



Not even official authorities dare to claim certainty about the sequencing of this alleged new virus, and thus of the primers and probes based thereupon :

https://www.researchgate.net/publication/340458688_Analytical_Validation_of_a_COVID-19_qRT-PCR_Detection_Assay_Using_a_384-well_Format_and_Three_Extraction_Methods

https://www.cdc.gov/coronavirus/2019-ncov/downloads/rt-pcr-panel-primer-probes.pdf

" *****DISCLAIMER******

These sequences are intended to be used for the purposes of respiratory virus surveillance and research. The recipient agrees to use them in compliance with all applicable laws and regulations. Every effort has been made to assure the accuracy of the sequences, but CDC cannot provide any warranty regarding their accuracy. The recipient can acknowledge the source of sequences in any oral presentations or written publications concerning the research project by referring to the Division of Viral Diseases, National Center for Immunization and Respiratory Diseases, Centers for Disease Control and Prevention, Atlanta, GA, USA.

Note: Oligonucleotide sequences are subject to future changes as the 2019-Novel Coronavirus evolves. " :

Also notice how authorities do NOT recommend their sequences for diagnostics !!!

Given the probability of false positive results due to, for instance :

- primer dimers

- mispriming

- cross reactivity

- sample contamination

- compresence of undetected other virus types in the sample

- cycles >30

- detection of dead/inactive viral material

- low hybridization stringency

- use of synthetic, in vitro RNA transcriptions for positive controls, instead of real-life samples

- poor primer design

- low annealing temperature (Ta) : one consequence of setting Ta too low (much lower than Tm) is that one or both primers will anneal to sequences other than the intended target and lead to non-specific PCR amplification :

how can any PCR-based "covid" diagnosis possibly be reliable /certain ?



https://www.fda.gov/media/134922/download

https://www.mlo-online.com/home/article/13005863/process-controls-internal-and-external

https://www.researchgate.net/topic/PCR-Primer-Design

" I have run thousands of both SYBR Green and TaqMan assays and even if the person performing the assay is highly skilled, the primer design will make or break the results. I've seen the opposite results come from poorly designed primers when compared to well designed primers. Self-designed primers also come with the required time and energy investment to properly validate and to ensure the melt-curves are appropriate. Worse, self-designed primers can also lead to unintentional bias for experimenters."

https://www.sciencedirect.com/science/article/pii/S2214753517302073#bib0060

https://sciencellonline.com/blog/how-to-improve-qpcr-specificity/

"Low specificity is mainly caused by non-specific binding of primers, which includes binding to similar sequences in the DNA template at random locations, binding between primers, and primer self-binding.

Designing robust primers for qPCR is a time-consuming and complicated process that requires expertise."

https://lockdownsceptics.org/might-most-positive-tests-be-wrong/

Even IF the virus really existed, the false-positive rate of the tests is so enormous as to render testing useless and criminally damaging for millions !!!

https://www.scientificamerican.com/article/coronavirus-antibody-tests-have-a-mathematical-pitfall/

https://www.aljazeera.com/news/2020/5/3/tanzania-president-questions-coronavirus-kits-after-animal-test

Here´s another foremost example of test fraud, quoted from a company´s own

warnings :

https://www.genscript.com/2019-ncov-qrt-pcr-detection-assay.html

" Disclaimers:

This assay is for Research Use Only (RUO) and has not been tested on clinical samples. We make no claims on the performance of this assay.

This assay’s design is impacted by the accuracy of the publically [sic!] SARS-CoV-2 genome sequence.

This assay’s performance is impacted by a range of uncontrolled and un-tested factors such as sample quality, various sample extraction methods, and data analysis variation.

This assay may have cross-reactivity with other coronavirus family members such as causative agents of the Middle East Respiratory Syndrome (MERS) or Severe Acute Respiratory Syndrome (SARS).

Stability tests and data are not available at this moment due to the emergency and time limits. We can not guarantee the accuracy of the shelf life, storage conditions, efficiency, etc. "



https://www.addgene.org/protocols/primer-design/

" However, primers do not need to correspond to the template strand completely; it is essential, however, that the 3’ end of the primer corresponds completely to the template DNA strand so elongation can proceed ":

implying that if the 3´end joined to the template DNA strand, is the same sequence in every corona for any given target gene of choice, your amplicon will easily end up crossreactive !!!

" When designing, if unsure about what nucleotide to put at a certain position within the primer, one can include more than one nucleotide at that position termed a mixed site. One can also use a nucleotide-based molecular insert (inosine) instead of a regular nucleotide for broader pairing capabilities." :

no comment !!! That makes it a joke for primer designers to skew their allegedly specific "sars-cov-2" primers into degenerate ones that will bind to any type of corona-like (or even any other) DNA they find !!!



The choice of setting parametres including specificity for PCR, is highly arbitrary :

https://genome.cshlp.org/content/3/3/S18.full.pdf

" The efficacy of PCR is measured by its specificity, efficiency (i.e. yield), and fidelity. A highly specific PCR will generate one and only one amplification product that is the intended target sequence. More efficient amplification will generate more products with fewer cycles. A highly accurate (i.e., high-fidelity) PCR, will contain a negligible amount of DNA polymerase-induced errors in its product. An ideal PCR would be the one with high specificity, yield, and fidelity. Studies indicate that each of these three parameters is influenced by numerous components of PCR, including the buffer conditions, the PCR cycling regime (i.e., temperature and duration of each step), and DNA polymerases. Unfortunately, adjusting conditions for maximum specificity may not be compatible with high yield; likewise, optimizing for the fidelity of PCR may result in reduced efficiency. Thus, when setting up a PCR, one should know which of the three parameters is the most important for its intended application and optimize PCR accordingly. For instance, for direct sequencing analysis of a homogenous population of cells (either by sequencing or by RFLP), the yield and specificity of PCR is more important than the fidelity. On the other hand, for studies of individual DNA molecules, or rare mutants in a heterogeneous population, fidelity of PCR is vital. The purpose of current communication is to focus on the essential components of setting up an effective PCR, and discuss how each of these component may influence the specificity, efficiency, and fidelity of PCR. "

" However, amplification of unspecific products in PCR, utilizing a specific 20-base primer, is not an unusual one. This is likely attributable to the fact that primers containing a number of mismatches are still amplified under most PCR conditions...Theoretically, there would be 180 places in the haploid mammalian genome where this will occur."

"The ratio of the primer to template is also important regarding the specificity of PCR. If the ratio is too high, PCR is more prone to generate unspecific amplification products, and also primer dimers are formed."

"The exponential phase of a PCR refers to the early cycle period during which the products accumulate in a manner that is consistent with the equation above. Continuing PCR beyond this point often results in amplification of unspecific bands, and, in certain instances, disappearance of the specific product (G. Hu, unpubl.)."

" Thus, if one were to carry out an analysis that is quantitative in nature, one must do so on the samples that are taken out at or before cycle 29. Because 1012 copies of a particular sequence is sufficient for most application in molecular biology, there is no apparent reason to carry out additional cycles."

"Specificity and yield can be readily determined by running a gel that separates DNA molecules according to their sizes (e.g., polyacrylamide or agarose gels). A highly specific PCR would generate one and only one product of the correct size. However, it is not unusual to observe a series of bands, especially when a new target sequence and/or primers are utilized for the first time. Appearance of unspecific amplification products can be attributed to a number of factors. First, primers may be annealing to unspecific sites in template DNA. In this case, one may be able to increase the specificity of PCR by changing reaction mixture that would make it more difficult for primers to anneal to unspecific sites in the sample. These include addition of glycerol, or formamide, reduced pH, or lowering concentrations of primers, dNTPs and MgC12. (~6'23'3~ One may also try altering the annealing temperature and/or the duration of the annealing and extension steps. In general, higher temperature, and shorter annealing and extension periods confer higher specificity. ~ Alternatively, the unspecific bands may have resulted from overamplification (Fig. 2; see Exponential Phase of PCR, below). In this case, one can simply reduce the number of cycles. As mentioned earlier, amplified products should be analyzed while they are still in the exponential phase of PCR. This is not only crucial for extracting quantitative information (e.g., calculating efficiencies, estimating the initial copy numbers), but also for generating the specific target sequence. Undesired consequences of overamplification include generation of small deletion mutants, appearance of unspecific bands, and in some cases disappearance of the specific product (G. Hu, unpublished observations). If none of these have a significant effect on the specificity of amplification, it may be necessary to change the primer; unfortunately, some primers simply do not work."



https://off-guardian.org/2020/11/20/portuguese-court-rules-pcr-tests-unreliable-quarantines-unlawful/

" An appeals court in Portugal has ruled that the PCR process is not a reliable test for Sars-Cov-2, and therefore any enforced quarantine based on those test results is unlawful.

Further, the ruling suggested that any forced quarantine applied to healthy people could be a violation of their fundamental right to liberty.

Most importantly, the judges ruled that a single positive PCR test cannot be used as an effective diagnosis of infection. " :

WHAT A FANTASTIC APPEALS COURT !! WHAT HEROIC JUDGES !! THEY BASED THEIR RULING OFF OF SOUND, HONEST, ACCURATE SCIENTIFIC RESEARCH :

" In their ruling, judges Margarida Ramos de Almeida and Ana Paramés referred to several scientific studies. Most notably this study by Jaafar et al., which found that – when running PCR tests with 35 cycles or more – the accuracy dropped to 3%, meaning up to 97% of positive results could be false positives. " :

AND SINCE WE KNOW THAT MOST TESTS CURRENTLY IN USE ARE RUN WITH 35 CYCLES OR MORE, WE CAN BE CERTAIN THAT PRACTICALLY ALL PEOPLE WHO TEST POSITIVE TO THE ALLEGED SARS COV 2 VIRUS AFTER A PCR TEST, ALSO CALLED MOLECULAR TEST, ARE FALSE POSITIVES !!!

" The ruling goes on to conclude that, based on the science they read, any PCR test using over 25 cycles is totally unreliable. Governments and private labs have been very tight-lipped about the exact number of cycles they run when PCR testing, but it is known to sometimes be as high as 45. Even fearmonger-in-chief Anthony Fauci has publicly stated anything over 35 is totally unusable. "

https://translate.google.com/translate?hl=&sl=pt&tl=en&u=http%3A%2F%2Fwww.dgsi.pt%2Fjtrl.nsf%2F33182fc732316039802565fa00497eec%2F79d6ba338dcbe5e28025861f003e7b30

http://www.dgsi.pt/jtrl.nsf/33182fc732316039802565fa00497eec/79d6ba338dcbe5e28025861f003e7b30

This is one of the scientific studies the Portuguese judges based their ruling off of :

https://academic.oup.com/cid/advance-article/doi/10.1093/cid/ciaa1491/5912603

Its authors crosschecked PCR-positive results by inoculating samples from the allegedly sars-cov-2- positive patients, into cell cultures, to see if the cells would get infected : well, here is the outcome :



" It can be observed that at Ct = 25, up to 70% of patients remain positive in culture and that at Ct = 30 this value drops to 20%. At Ct = 35, the value we used to report a positive result for PCR,
The authors cite another scientific study by Bullard et all., also based on inoculating healthy cells, with PCR-positive samples at more than 24 amplification cycles : no cells showed any viral growth whatsoever ! Which implies, that even if a bit of viral matter is detected by PCR testing above 24 cycles, it is not infectious at all !!! :

" SARS-CoV-2 Vero cell infectivity was only observed for RT-PCR Ct
" A major drawback to PCR and other diagnostic approaches (including other NA, serology, and antigen detection) is that they all fail to determine virus infectivity; PCR sensitivity is excellent but specificity for detecting replicative virus is poor . "

" These results demonstrate that infectivity (as defined by growth in cell culture) is significantly reduced when RT-PCR Ct values are > 24. For every 1-unit increase in Ct, the odds ratio for infectivity decreased by 32%. "

https://www.science.org/doi/10.1126/science.370.6512.22



https://academic.oup.com/cid/article/71/10/2663/5842165



https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7524437/

file:///C:/Users/yyy/AppData/Local/Temp/viruses-12-00211.pdf

"As effective as they are, PCR tests are sometimes prone to major pitfalls, chiefly owing to high mutability of a viral genome, which significantly perplexes primer design and requires researchers to update primer sequences continually. With the entirety of human-infecting viruses, most of which are yet to be revealed, it becomes increasingly difficult to maintain up-to-date primer panels while also ensuring the correct reaction conditions and high specificity for differentiating closely related viral species. This situation is aggravated by the low rates of correct pathogen identification ."

" RT-PCR has been extensively used for studying viral genera, for which a significant number of primers have been designed . Since the potential of this method became apparent, many enterprises have stepped in, developing commercial PCR kits for reliable fast-track diagnosis of infections like enterovirus,influenza, herpes simplex, etc. While effective and highly sensitive, these panels by design cannot identify new strains and types with altered target sequences. Because of possible genetic similarities between known and previously undiscovered viruses, primers might anneal incorrectly, resulting in false positives and taxonomic misidentification. Multiplexing of primers and probes can be challenging, as there is always a risk of cross-specificity and primer-dimer formation. While separating reactions solves this issue, it requires greater volumes of clinical samples, which are usually limited. Furthermore,in the case of probes, the number of targets is strictly limited to a handful of available fluorophores."

" There is evidence that metagenomic sequencing is restricted by multiple pitfalls and biases, based on the pathogen’s structure, extraction method, GC content, and other factors. Therefore, there are five major limitations: (1) sequences of interest should share at least low identity with the analogous sequences in a reference genome,ensuring correct mapping; (2) the analytical complexity of obtained data often requires employment of a qualified bioinformatician and the use of a specialized computational infrastructure (including both hardware and software); (3) hidden experimental and methodological prejudices towards certain taxa;(4) defining the method’s sensitivity and properly measuring it against a relevant reference; (5) dealing with the abundance of host-cell, bacterial and fungal nucleic acids. "

https://meridian.allenpress.com/aplm/article/141/6/776/129024/Validation-of-Metagenomic-Next-Generation

https://principia-scientific.com/who-finally-admits-covid19-pcr-test-has-a-problem/

https://www.who.int/news/item/14-12-2020-who-information-notice-for-ivd-users

https://principia-scientific.com/using-pcr-tests-to-diagnose-covid19-is-bad-science-fraudulent/

https://archive.is/MdDCX

https://en.wikipedia.org/wiki/Nested_polymerase_chain_reaction

" Conventional PCR requires primers complementary to the termini of the target DNA. The amount of product from the PCR increases with the number of temperature cycles that the reaction is subjected to. A commonly occurring problem is primers binding to incorrect regions of the DNA, giving unexpected products. This problem becomes more likely with an increased number of cycles of PCR."

But even so-called nested PCR, that uses 2 primer sets for increased specificity, is not 100% specific, and only amplifies a genomic fragment chosen by an arbitrary primer design that is only supposed to anneal to an alleged viral sequence : if the sequencing of the reference genome was biased and wrong to begin with, as we saw, this fragment amplified in nested PCR, whether specific or not, proves nothing at all.

So where is a comparison between sars2 and the 4 known coronas ?

Further : the above "study" only could compare subgenomic sgRNA - structural proteins being by implication identical.

I find nowhere, how the alleged sars2 compares to the known 4 :

5. 229E (alpha coronavirus)

6. NL63 (alpha coronavirus)

7. OC43 (beta coronavirus)

8. HKU1 (beta coronavirus)

Here is a study, again based on the zhou paper not on direct isolation/microscopy, detailing differences against other sarses but not the 4 known, common coronaviruses NL63, 229E, OC43 and HKU1 - the only time it mentions one of the 4, it is to say that the second allegedly unique feature of sars cov 2 is really common with HKU1 ! :

" 2. Polybasic furin cleavage site and O-linked glycans

The second notable feature of SARS-CoV-2 is a polybasic cleavage site (RRAR) at the junction of S1 and S2, the two subunits of the spike8 (Fig. 1b). This allows effective cleavage by furin and other proteases and has a role in determining viral infectivity and host range12. In addition, a leading proline is also inserted at this site in SARS-CoV-2; thus, the inserted sequence is PRRA (Fig. 1b). The turn created by the proline is predicted to result in the addition of O-linked glycans to S673, T678 and S686, which flank the cleavage site and are unique to SARS-CoV-2 (Fig. 1b). Polybasic cleavage sites have not been observed in related ‘lineage B’ betacoronaviruses, although other human betacoronaviruses, including HKU1 (lineage A), have those sites and predicted O-linked glycans13."

Again one can see very well here, that whatever structural protein a PCR targets, it is going to be common with the 4 :

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7395230/figure/f0015/?report=objectonly

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7395230/

except for the presence of some different ORFs - but if your primers bind to the proteins alone, it is the same proteins in the same sequence, so how is cross reactivity avoided with certainty ?

In fact, according to the PCR package inserts collected by Crowe, it NEVER is !!!

https://www.ukcolumn.org/article/covid-19-hoax

http://philosophers-stone.info/wp-content/uploads/2020/11/The-scam-has-been-confirmed-Dsalud-November-2020.pdf

https://www.youtube.com/watch?v=oWBRNwoUqFY&t=8s

https://blog.nomorefakenews.com/2018/04/04/the-gold-standard-of-medical-tests-is-fake/

https://theinfectiousmyth.com/book/CoronavirusPanic.pdf

https://twitter.com/DavidRCrowe

https://theinfectiousmyth.com/coronavirus/EvidenceExistenceCOVID19Corbett.pdf

https://theinfectiousmyth.com/coronavirus/RT-PCR_Test_Issues.php

https://lockdownsceptics.org/the-incredible-and-scary-truth-about-covid-19-tests-2/

https://twitter.com/InfectiousMyth/status/1250138967799779328

https://www.projectveritas.com/

https://thevaccinereaction.org/2021/02/who-issues-new-guidance-on-use-of-pcr-tests/#_edn4

No, there is no such thing as a special test for the alleged "covid 19". Covid 19 is the official name they gave this alleged disease. The name for the virus is sars-cov-2. Now, if a virus is inside your body, it does NOT necessarily imply that you are sick. Just that you are "positive" to that particular virus. So : you might be sars-cov-2- positive, but still not have the disease covid 19 : not be sick.

Ok ? This is a very important difference, never forget it . Now : nobody has given us any solid evidence that this alleged new type of coronavirus, sars-cov-2, really exists. And there is no evidence that, IF it exists, it is the cause of the alleged disease called covid 19. What you hear from the massmedia is only lies : in the world of true science, it takes over a year to confirm the existence of a new virus, and its pathogenicity, that is to say, the fact that it does cause a new disease. Now : there are 2 main types of tests that are believed (falsely) to detect a virus in your body : the first test is called RT-PCR, or just simply PCR ; the second test is called serological, as it analyzes the serum (a part of your blood) in search of antibodies revealing that you are being or have been exposed to a virus. Neither of these 2 tests is specific to any particular virus, though they might claim otherwise. Let me give you 2 examples from commercially available PCR tests being used these days , I shall quote from the labels, the company labels that come with these tests : - Abbott : "Positive results do not rule out bacterial infection or co-infection with other viruses...Due to the high sensitivity of the assays run on the instrument, contamination of the work area with previous positive samples may cause false positive results" ; - Accula : " Cross-reactivity with respiratory tract organisms other than those listed in the Analytical Specificity Study may lead to erroneous results…" : what they are saying is : we cannot guarantee through our test that you are positive to sars-cov-2 because our test may confuse sars-cov-2 with everything else, any other kind of RNA in your cells or other things !!! It´s a hoax, it´s a swindle, it is global pharma nazism to terrorize us all into buying their useless and harmful vaccines and drugs and face masks and disinfectants that will only cause one allergies and poisonings, and accept total control of our lives, contact tracing etc., under the false pretext of a pandemic that does NOT exist.

THERE IS NO SARS-COV-2 virus no covid disease no pandemic it´s all a pharmanazi hoax for profit :

https://twitter.com/DavidRCrowe

https://www.youtube.com/watch?v=NYr2jJf-zZ0&t=187s

https://www.youtube.com/watch?v=oWBRNwoUqFY&t=8s https://blog.nomorefakenews.com/2018/04/04/the-gold-standard-of-medical-tests-is-fake/ https://theinfectiousmyth.com/book/CoronavirusPanic.pdf https://twitter.com/DavidRCrowe https://theinfectiousmyth.com/coronavirus/EvidenceExistenceCOVID19Corbett.pdf https://theinfectiousmyth.com/coronavirus/RT-PCR_Test_Issues.php https://lockdownsceptics.org/the-incredible-and-scary-truth-about-covid-19-tests-2/ https://twitter.com/InfectiousMyth/status/1250138967799779328 https://www.projectveritas.com/

https://www.youtube.com/watch?v=o7A_cMpKm6w&t=5s

https://www.youtube.com/watch?v=yaOvva72b7o

https://uncoverdc.com/2020/04/07/was-the-covid-19-test-meant-to-detect-a-virus/



Y believe in the unproven existence of the alleged sars cov 2 virus and its alleged variants and covid disease and pandemic ?

1. alleged virus never purified 2. alleged virus allegedly sequenced by way of arbitrary, biased bioinformatic algorithms 3.alleged-virus alleged pathogenicity never ascertained 4. alleged disease features no symptoms of its own 5. all tests in use amount to fraud, in that unreliable and unspecific

1. the virus was never isolated (=purified). That means, freed from all surrounding tissue:

https://theinfectiousmyth.com/coronavirus/IsolationVersusPurification.php

2. in order to have a new virus, you need to sequence it, that is discover and describe its genomic structure, that is the sequence of bases in its RNA as viruses are made of RNA : this has been claimed on the basis of technologies yet experimental with error rates as high as 30 % : again no proof of existence there. To give you an example for comparison, with an error rate of 3% your DNA would identify you as a chimp.

3. pathogenicity means the causal relationship between a virus and a disease it causes : it takes at least a year to ascertain this, that a given virus actually cause a given disease, because u have to crosscheck your results by wave upon wave of experiments on animals, cell cultures etc. : it has never been done for the alleged sars cov 2.

4. when an alleged disease such as the alleged covid features no original symptoms whatsoever, but instead identical symptoms with known diseases, it is NOT a new disease and it doesn´t exist ;

5. the most commonly used covid test is called PCR or molecular test : swab sample viral RNA gets amplified, that is copied, billions of times to make it detectable if it is there : but all PCR devices in use run the test at well over 35 cycles, that is runs of amplification or copying : experts agree 100% that such tests at over 35 cycles do NOT repeat NOT, NEVER detect a quantity of viral matter large enough to cause disease. It´s a total scam : these "covid" tests ARE DESIGNED TO GENERATE FALSE POSITIVES :

https://cormandrostenreview.com/report/

The choice of setting parametres including specificity for PCR, is highly arbitrary :

https://genome.cshlp.org/content/3/3/S18.full.pdf

"The ratio of the primer to template is also important regarding the specificity of PCR. If the ratio is too high, PCR is more prone to generate unspecific amplification products, and also primer dimers are formed."

"The exponential phase of a PCR refers to the early cycle period during which the products accumulate in a manner that is consistent with the equation above. Continuing PCR beyond this point often results in amplification of unspecific bands, and, in certain instances, disappearance of the specific product (G. Hu, unpubl.)."

" Thus, if one were to carry out an analysis that is quantitative in nature, one must do so on the samples that are taken out at or before cycle 29. Because 1012 copies of a particular sequence is sufficient for most application in molecular biology, there is no apparent reason to carry out additional cycles."

https://visegradpost.com/en/2021/04/03/an-austrian-tribunal-call-into-question-pcr-tests/

Let us now debunk the CDC´s fraudulent PCR test :

https://www.fda.gov/media/134922/download

Go to page 4 :

" Positive results are indicative of active infection with SARS-CoV-2 but do not rule out bacterial infection or co-infection with other viruses. The agent detected may not be the definite cause of disease." :

in other words, the CDC´s PCR test is worthless, in that if you are sick, it cannot tell you from what. They are just pretending to detect an alleged virus in your body that has not been proven to exist nor to cause disease in general or the particular disease you may be suffering from when testing. So how on earth can such an inconclusive test be used as the basis for treatment of a disease whose cause and nature it cannot detect ?

Also notice how the CDC fraudsters insist on their test aiming at qualitative virus detection : not quantitative : but every PCR expert will tell you, that even if PCR does detect viral RNA in your sample, only its quantity determines whether you may be infected and contagious or not : above 30 amplification cycles, even assuming this sars cov 2 ghost existed and PCR detected it in your body, its quantity would be way too small to be either infectious or contagious.

Even the manufacturer of the computerized PCR system that the CDC has been using, Applied Biosystems 7500 Fast Real-Time PCR System, explicitly states :

" For Research Use Only.

Not for use in diagnostic procedures." !!!!!!!!!!

https://www.gene-quantification.de/abi7500.pdf

And yet the CDC, contravening such a clear warning, does precisely that on page 5 : it recommends using this system for diagnosing sars cov 2 !!! :

" The panel is designed for specific detection of SARS-CoV-2 (two primer/probe sets).

RNA isolated and purified from upper and lower respiratory specimens is reverse transcribed to cDNA and subsequently amplified in the Applied Biosystems 7500 Fast Dx Real-Time PCR Instrument with SDS version 1.4 software." !!!!!!!!!!! STOP THIS SCAM NOW !!!



On page 13 of the CDC link :

https://www.fda.gov/media/134922/download

there´s a very strange command for state and local labs - to ship all specimens to the CDC : why ?

This is a gross volation of people´s and patients´ privacy : the CDC is harvesting everybody´s DNA in this way !!

DO NOT TEST FOR THIS GHOST, DO NOT GIVE AWAY YOUR MOST INTIMATE PHYSICAL PRIVACY TO FRAUDSTERS !!!

https://www.fda.gov/media/134922/download

Page 14 : the systems the CDC recommends for extracting RNA from patient samples are :

- Qiagen QIAamp® DSP Viral RNA Mini Kit or QIAamp® Viral RNA Mini Kit

a system assessed as poorly sensitive and often leading to false positive results in this 2018 study :

https://www.researchgate.net/publication/324482623_External_Quality_Assessment_for_Zika_Virus_Molecular_Diagnostic_Testing_Brazil

- Qiagen EZ1 Advanced XL, page 15 :

a system deemed even worse in terms of extraction efficiency in the following scientific review :

https://www.izs.it/vet_italiana/2018/54_2/VetIt_1133_6147_3.pdf

Before I go on debunking this mockery of science, let me remind the reader that these fraudulent kits are supposed to be extracting RNA from a sample - ANY RNA that might be there, including perfectly healthy or unrelated RNA. Thereafter, primers get injected into this whatever RNA, primers that are short fragments of an alleged sars cov 2 sequence that has NEVER been proven to exist but only strung together by way of arbitrary, biased computer algorithms ; and such alleged primers are supposed to attach to possible sars cov 2 RNA if it is there. Trouble is, these primers are prone to stick to whatever RNA sequence there for many reasons outlined elsewhere in this study ! PCR for the alleged covid is DESIGNED to generate false positives !!

- Roche MagNA Pure 96

this is the next big-pharma extraction kit recommended by the CDC on p.15. Well, it debunks itself once again, in its operator´s guide p. 197 :

https://lifescience.roche.com/documents/MagNA-Pure-96-System-Operators-Guide-Version-2-0.pdf

" For life science research only.

Not for use in diagnostic procedures."

On with the show :

- Roche MagNA Pure 24 is the nex RNA extracton kit recommended and authorized by the CDC on p.15 : same self-debunking here :

https://lifescience.roche.com/en_it/brands/magnapure.html

Go the small print at page bottom :

" Products are for life science research only. Not for use in diagnostic procedures unless otherwise indicated." : fuck you cdc, you frauds ain´t nothing but pig pharm shills !!!

Let us continue listing and debunking the fraudulent RNA extraction kits authorized by the criminal CDC on page 15 here :

https://www.fda.gov/media/134922/download

- Promega Maxwell® RSC 48 and Maxwell® CSC 48, on page 15 of the cdc link above :

again another self-debunker here :

https://ita.promega.com/products/lab-automation/maxwell-instruments/maxwell-rsc-48-instrument/?catNum=AS8500

Go to "specifications" near page bottom and this is what you find...guessed yet ? :

" Use Restrictions

For Research Use Only. Not for Use in Diagnostic Procedures." :

so why on earth are you recommending and authorizing these kits for sars cov 2 diagnostic procedures, you cdc liars and cheats ???

Do you realize, dear readers, that if the manufacturers themselves prohibit the use of their devices for diagnostics, it means they are fully aware that RNA extraction performed with them is error-prone, and is only viable for research over a long span of time, where errors can be detected and calmly assessed by many controls and checks, whereas all of this is impossible over the short time span diagnostics have to operate in ? Not to mention the context of a fake emergency such as the present one, when NO controls and checks and crosschecking is feasible in the labs because they are forced to deliver results in a matter of minutes or hours ? Do you realize that if RNA has been improperly extracted from your sample, for instance mixed with human DNA or contaminated with other pathogens, the whole PCR test result might turn out to be falsely positive ? Always bear in mind that primer specificity for sars cov 2 is a laugh and a joke.

The nex advertized extraction kit on the cds´s trick-turning website is :

- QIAGEN QIAcube on p.16. Another self-shooting in the foot for the cdc. The manufacturers themselves RULE OUT DIAGNOSTIC APPLICATION FOR THEIR KIT :

https://www.qiagen.com/us/products/instruments-and-automation/nucleic-acid-purification/qiacube-connect/?cmpid=PC_QF_NON_qiacube-sales_0220_SEA_GA&gclid=EAIaIQobChMIkZnk4aDR8wIVRwOLCh3LYAjlEAAYASAAEgIcl_D_BwE

Scroll to about 1/3 down, section "Applications" :

" Applications

QIAcube Connect is highly suitable for academic research laboratories as well as pharmaceutical, biotechnology, and biomedical research laboratories performing applications, such as:

Sequencing/sequencing analysis

Gene expression analysis

Genotyping

Proteomics

Microbiome research " : ANYTHING BUT DIAGNOSTICS !!!

Moreover, qiacube performed poorest in the following external quality assessment :

"There are not many publications about the QIAcube and very few have done some kind of

evaluation of it. On publication that has is Bhattacharya, Das, Pandey, Harishankar, & Chandy ́s

publication from 2016. There they evaluated fungal DNA extraction with two kits, one of which

they made an alteration to so that they in the end did three different extractions, and two

methods, manually (two extractions) and with the help of a QIAcube (one extraction). Their

conclusion was that the QIAcube extraction performed the poorest in both purity and

concentration."

https://www.diva-portal.org/smash/get/diva2:1454595/FULLTEXT01.pdf

page 14. And more damning evaluation on p.15 :

" The next parameter being measured was the purity of the samples and this was measured by a

nanodrop (Table 3). In Figure 5 it can be seen that Q200 was significantly larger then M100 and

Q100. However none of the purity values in all of the extractions did reach the value which is considered pure." :

again let me stress the importance of this : if the extracted RNA from your swab sample is not pure, it means it´s contaminated with all manner of possible pathogens or human DNA etc. - leading to FALSE POSITIVE GALORE AS PCR TESTING RESULTS !!!

Here is the orinal report from the Indian scientists re qiagen extraction referenced above :

https://www.researchgate.net/publication/312059479_A_high_yield_DNA_extraction_method_for_medically_important_Candida_species_A_comparison_of_manual_versus_QIAcube-based_automated_system

" QIAcube extraction (Protocol C) showed a poor DNA yield compared to other tested protocols [Figure 1]." :

that´s on p.534 of the original paper publication.

https://www.fda.gov/media/134922/download

- p. 16 : Roche MagNA Pure LC : yet another self-debunker :

" Products are for life science research only. Not for use in diagnostic procedures unless otherwise indicated." :

https://lifescience.roche.com/en_it/products/magna-pure-lc-2-0-instrument.html

(scroll down to page bottom, small print).

- p.16 : Roche MagNA Pure Compact : ditto :

https://lifescience.roche.com/en_it/products/magna-pure-compact-instrument.html#application

again, scroll down to small print at page bottom :

" Products are for life science research only. Not for use in diagnostic procedures unless otherwise indicated."

-p.16 : bioMérieux NucliSENS® easyMAG® Instrument and bioMérieux EMAG® Instrument : here´s how reliable they are :

" https://www.foodnavigator.com/Article/2017/01/30/BioMerieux-expands-Class-I-medical-device-recall "

I THINK I´VE PROVIDED MORE THAN ENOUGH SCIENTIFIC EVIDENCE THAT THE RNA EXTRACTION KITS AUTHORIZED BY THE CDC FOR ITS "SARS COV 2" PCR TEST PROTOCOL ARE GARBAGE AND A MOCKERY OF SCIENCE AND JUST SIMPLY DESIGNED TO GENERATE FALSE POSITIVES, A FAKE PANDEMIC OF A FAKE DISEASE !!!

Just what hope of medical data confidentiality there can there be with these extraction kits, and PCR test kits, all of which run on criminal against humanity bill gates´ windows ? Do u realize just how deeply the guy´s involved with the convid scam and why ?

https://www.fda.gov/media/134922/download

On page 32, figure 17 shows at the bottom that the PCR system recommended by the CDC, Applied Biosystems 7500 Fast, is set to run 45 amplification cycles : which is absurd and designed to generate false positives, as every PCR expert in the world starting with world leading one Stephen Bustin would tell you, that any result obtained above 35 cycles is uncertain, and even if positive, the sample would contain such a small quantity of viral load as to be noninfectious, noncontagious and irrelevant.

On page 35, the CDC expressedly recommends to run up to 40 cycles !! This is outright fraud.

The absurdity os such a test for diagnostics is confirmed on page 38 :

" • Detection of viral RNA may not indicate the presence of infectious virus or that 2019-nCoV is the

causative agent for clinical symptoms.

• The performance of this test has not been established for monitoring treatment of 2019-nCoV

infection.

• The performance of this test has not been established for screening of blood or blood products

for the presence of 2019-nCoV.

• This test cannot rule out diseases caused by other bacterial or viral pathogens. " :

ANY HONEST CDC, ANY HONEST DOCTOR AT THIS POINT WOULD RULE OUT USING SUCH A SYSTEM FOR DIAGNOSTICS OF ANY KIND !!! AND YET THIS IS HOW "CASES" ARE BEING GENERATED : BY WAY OF PCR FRAUD, THE RESULTS WHEREOF ARE A MOCKERY OF SCIENCE AND MEAN NOTHING AT ALL ! STOP TESTING FOR A LIE AND A HOAX !!



https://www.fda.gov/media/134922/download

On page 40, the charade reaches its most absurd climax :

" Since no quantified virus isolates of the 2019-nCoV were available for CDC use at the time the test was developed and this study conducted, assays designed for detection of the 2019-nCoV RNA were tested with characterized stocks of in vitro transcribed full length RNA (N gene; GenBank accession: MN908947.2) " :

IN PLAIN ENGLISH, THE CDC NEVER HAD THE ALLEGED LIVE VIRUS AT ALL !!!

THEY DEVELOPED THEIR ARCHFAKE TESTING PROTOCOL BY SYNTHESIZING THE ALLEGED N GENE OF THE ALLEGED SARS COV 2 VIRUS THEY NEVER SAW, BASED ON SOME UNVERIFIED DATABANK SEQUENCE !!! THIS IS A MOCKERY OF

SCIENCE !!!

NOBODY IN THE WORLD HAS THIS GHOST VIRUS, NOT THE VAX MANUFACTURERS, NOR THE CDC, NOR ANY GOVT IN THE WORLD !!! IT´S A SCAM, IT´S A HOAX, STOP TESTING AND VACCINATING AND COMPLYING WITH THIS FRAUDULENT PHARMANAZI IV

REICH !!!!!!!!

Next : the CDC provides the sequences for its PCR primers here :

https://www.cdc.gov/coronavirus/2019-ncov/downloads/rt-pcr-panel-primer-probes.pdf

The first one, the forward primer, is supposed to be a segment of the N (Nucleocapside) part of the alleged sars cov 2 virus :

GACCCCAAAATCAGCGAAAT

Now try running this sequence through the search software BLAST :

https://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=MicrobialGenomes

enter fasta sequence of CDC reverse primer :

TCTGGTTACTGCCAGTTGAATCTG

Tick the "all genomes" and "highly similar" boxes. Click on BLAST at page bottom.

This is what you get : 100 highly similar sequences to the CDC´s forward primer !! Many of them belonging to microorganisms commonly present in our bodies, thus obtaining by design, a 100x chance of crossreaction - that is, of false positivity to the nonexistent sars cov 2 virus :





" At room temperature, PCR primers can anneal to template sequences that are not perfectly complementary." :

https://ita.promega.com/resources/guides/nucleic-acid-analysis/pcr-amplification/

A similar claim was put forward in 2020 by someone who had discovered that one of the primers used by the pasteur institute in paris for its own covid PCR test, matched a segment of human chromosome 18 !! This claim has been debunked by mainstream sites such as this one :

https://healthfeedback.org/claimreview/human-dna-alone-does-not-produce-a-positive-result-on-the-rt-pcr-test-for-sars-cov-2/

But we´ve seen above how such a debunking is false, as one primer alone CAN indeed set off a PCR amplification. And it is NOT true that if this were the case, every test subject would test positive : it is not true because in theory, the sample once it has been filtered for its RNA alone, and transcribed to DNA to make PCR possible, should NOT contain original human DNA sequences at all, but only RNA sequences recoded into DNA. Contamination as described above does not occur all the time !!! But often enough to generate all the false positive tests passed off as covid cases !!!

THIS IS FRAUD ON A PLANETARY SCALE !!!!!!!

STOP TESTING FOR THIS HOAX !!!!!!!!!!

Next : the CDC provides the sequences for its PCR primers here :

https://www.cdc.gov/coronavirus/2019-ncov/downloads/rt-pcr-panel-primer-probes.pdf

Now if we try the same BLAST search with the reverse primer sequence (TCTGGTTACTGCCAG TTGAATCTG), the astonishment turns into a scandal : 100 high similarities with all sorts of genomes both animal and vegetal !!!

https://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=MicrobialGenomes

enter fasta sequence of CDC reverse primer :

TCTGGTTACTGCCAGTTGAATCTG

Tick the "all genomes" and "highly similar" boxes. Click on BLAST at page bottom.

And again, you get 100 highly similar sequences to this reverse primer ! 100 ! A 100x chance of crossreaction with totally different microbes commonly occurring in our organism !! :





So there you have it : both CDC primers for their fraudulent PCR covid test protocol, were designed to crossreact with some 100 common pathogens, in order to generate false positives to the nonexistent sars cov 2 virus.

Similar results had been obtained in November 2020 by two great Spanish researchers, Jesus Garcia Blanca and Juan Pedro Aparicio Alcaraz :

https://philosophers-stone.info/wp-content/uploads/2020/11/The-scam-has-been-confirmed-Dsalud-November-2020.pdf

https://www.dsalud.com/revistas/numero-242-noviembre-2020/

https://www.dsalud.com/reportaje/la-estafa-se-constata-la-pcr-no-detecta-el-sars-cov-2/

CHAPTER 8 : ANTIBODY TESTING AND THERAPY, ANTIGEN TESTS, LAMP TESTS : COMMERCIAL FRAUD

Antibody tests for the alleged virus sars-cov-2 and the relative alleged disease covid 19 are a fraud : what big pharmers do is, they produce a synthetic protein in their labs, called S protein because it is allegedly present in the spike of the alleged sars-cov-2 coronavirus : this artificial protein is produced in the lab, according to formulas from genebanks which have never been independently and scientifically verified. So they then proceed to coat their test grid with this S protein, and expose it to serum or plasma : if there are antibodies, for whatever reason, in your serum or plasma, they will attack this S-protein, because the S-protein enters our cells by attaching itself to a substance called ACE2 receptor. So if we develop antibodies that attack these infected cells where the S protein has entered thru this door called ACE2, they´ll say that we are positive to covid 19 - to the alleged disease covid 19. That´s a a lie : because there are other types of known coronaviruses causing for instance some 15% or so of the common cold : and these common coronas, such as NL63, that have been around forever, also feature the S-protein in their spikes, and also use the ACE2 receptor in our cells to enter them.

Therefore if you turn out to be positive to these fraudulent tests, it does NOT imply that you have or have had the alleged disease called covid 19 : you might have responded with antibodies that targeted S-1 because when you have had a cold, that´s what you do. In other words : antibody testing is a fraud, it´s totally artificial, it´s meant to stigmatize as many humans as possible and force them into treatment that is more harmful than what they might really have - often, a common cold.

DO NOT GO FOR THESE TESTS, REFUSE TO BE SUBMITTED TO THESE FRAUDULENT, CRIMINAL ANTIBODY TESTING FOR AN ALLEGED VIRUS/DISEASE THAT HAS NOT EVEN BEEN PROVEN TO EXIST IN THE FIRST PLACE.

Even big pharma fraudsters such as the hoffman-family´s roche company, warn us that their sars-cov-2-antibody test is totally unreliable :

" False positive results for the Elecsys Anti‑SARS‑CoV‑2 assay may occur

due to cross reactivity from pre-existing antibodies or other possible

causes " :

https://www.fda.gov/media/137605/download

https://fr.wikipedia.org/wiki/Coronavirus

http://theinfectiousmyth.com/coronavirus/AntibodyTestingForCOVID.pdf

https://www.corriere.it/salute/malattie_infettive/cards/guerra-vaccini-chi-vincera/sfida-senza-precedenti_principale.shtml?refresh_ce-cp

https://www.corriere.it/salute/20_maggio_06/plasma-curare-coronavirus-entusiasmi-polemiche-ma-non-abbiamo-ancora-evidenze-35c35864-8fdd-11ea-bb7f-d3d655d2211a.shtml

ANTIBODY THERAPY : ANOTHER SCAM

https://www.foxnews.com/science/covid-cure-california-biopharmaceutical-coronavirus-antibody-breakthrough

https://www.google.it/search?ei=lmjCXsXgFICj1fAPgoGBuAo&q=adverse+side+effects+of+antibody+therapy&oq=adverse+side+effects+of+antibody+therapy&gs_lcp=CgZwc3ktYWIQAzoOCAAQ6gIQtAIQmgEQ5QI6BAgAEEM6BQgAEIMBOgIIADoECAAQCjoGCAAQFhAeOgQIABATOggIABAWEB4QEzoFCCEQoAE6BAghEBU6BwghEAoQoAE6CAghEBYQHRAeULLnAlilxwNgjdMDaAFwAHgAgAHCAYgB4B6SAQUyOS4xMZgBAKABAaoBB2d3cy13aXqwAQY&sclient=psy-ab&ved=0ahUKEwjFg4CDn73pAhWAURUIHYJAAKcQ4dUDCAs&uact=5#spf=1589799121932

"In general, the more common side effects caused by monoclonal antibody drugs include:

Allergic reactions, such as hives or itching.

Flu-like signs and symptoms, including chills, fatigue, fever, and muscle aches and pains.

Nausea, vomiting.

Diarrhea.

Skin rashes.

Low blood pressure."

Plus worse, potentially lethal ones such as anaphylactic shock :

https://en.wikipedia.org/wiki/Monoclonal_antibody_therapy

"However, the immune response to certain antigens may be inadequate, especially in the elderly. Additionally, adverse reactions from these antibodies may occur because of long-lasting response to antigens. Passive monoclonal antibody therapy can ensure consistent antibody concentration, and can control for adverse reactions by stopping administration. However, the repeated administration and consequent higher cost for this therapy are major disadvantages. "

" Major problems associated with murine antibodies included reduced stimulation of cytotoxicity and the formation complexes after repeated administration, which resulted in mild allergic reactions and sometimes anaphylactic shock.

These antibodies suggested as therapy are not natural, they are synthesized in the lab, by mixing human, animal and synthetic sections ; and bear in mind that the spike protein of the new alleged coronavirus sars-cov-2 that these pharma usurers are experimenting with, is also lab-made and not extracted from infected samples ! Lab-made according to a formula registered by the chinese into genebank, a global genomic database, that nobody has verified conclusively so far in the real world.

Mainstream media parrots are making a big deal about new tests targeting specific antibodies, that is sars-cov-2-antigen-specific antibodies : aside from the danger of crossreactivity, generally speaking, is each antibody specific and unique for each antigen ? Does each virus type produce specific and unique antigens ?

Here´s what doctor David Rasnick said about these proliferating antiboy tests :

" Each virus produces antigens common to the family of viruses, and antigens common to the strain of virus. Viruses (especially RNA viruses) produce different antigens every time they replicate.

Your body produces about one trillion B-cells producing a trillion different antibodies. The trillion different antibodies attach to a protein antigen (most antigens are proteins) strongly (highly specific), moderately or slightly (non-specifically), and the overwhelming majority not at all. The range of these antibodies are called polyclonal antibodies.

Truly specific antigen-antibody reactions exist only in the laboratory—the so-called mono-clonal antibodies. "

Is there a danger there, that these serological tests would detect antibodies to antigens from common coronaviruses, and this might be sold for sars-cov-2 positivity ?

"The antibody tests always show a range of binding between viral test antigens and a person’s polyclonal antibodies. As with the HIV antibody tests, there is an arbitrary cut-off point of antibody-antigen reaction intensity, above the point is positive and below is negative.

There are over 80 documented ways a person who has never been exposed to HIV can have a positive result on the HIV antibody tests. This is true for any virus."

https://en.wikipedia.org/wiki/Monoclonal_antibody

https://www.creative-diagnostics.com/news-sars-cov-2-antigens-and-antibodies-79.htm

https://www.thelancet.com/journals/lancet/article/PIIS0140-6736(20)30788-1/fulltext

https://www.medrxiv.org/content/10.1101/2020.03.18.20038059v1.full.pdf

Antibody testing is fraud : from the package insert of one of these bogus test kits : https://www.assaygenie.com/covid-19-rapid-poc-test/

" Results from antibody testing should not be used as the sole basis to diagnose or exclude SARS-CoV-2 infection or to inform infection status. Positive results may be due to past or present infection with non-SARS-CoV-2 coronavirus strains, such as coronavirus HKU1, NL63, OC43, or 229E." :

you´ll test positive even if you have a common cold ! and they will kill you with heavy treatment, quarantine etc.

DO NOT GO FOR IT !!!!!!!!!!!!!

Antibody testing is unreliable, total fraud - this according to the WHO itself :

" Antibody detection tests targeting COVID-19 may also cross-react with other pathogens, including other human coronaviruses.

Based on current data, WHO does not recommend the use of antibody-detecting rapid diagnostic tests for patient care " :

https://www.who.int/news-room/commentaries/detail/advice-on-the-use-of-point-of-care-immunodiagnostic-tests-for-covid-19

ANTIBODY TESTS ARE UNABLE TO DETECT WITH CERTAINTY SPECIFIC ANTIBODIES TO THIS ALLEGED SARS-COV-2 VIRUS WHOSE VERY EXISTENCE HAS NOT BEEN PROVEN IN ANY SCIENTIFIC WAY : HERE IS PROOF QUOTED FROM THE PACKAGE INSERT OF ONE OF THESE FRAUDULENT SEROLOGICAL TEST KITS .

" The reactive result obtained with WANTAI SARS-CoV-2 Ab Rapid Test alone cannot be the final diagnosis of COVID-19. Any reactive results must be interpreted in conjunction with the patient clinical history and another laboratory testing results. Follow-up and supplementary testing of all reactive specimens with other tests is required to confirm any reactive result." :

http://www.dbaitalia.it/newsletter/wantai_sars-cov-2_ab_rapid_test_-_ce_ifu.pdf

SO DO NOT TAKE THESE TESTS THEY ARE A FRAUD DON´T DO IT AT HOME OR ANYWHERE ELSE THIS WHOLE PANIC IS A PHARMANAZI HOAX FOR PROFIT AND FASCIST CONTROL OF OUR LIVES !!!!!

https://en.wikipedia.org/wiki/Antibody#Specificity_designations

Antibody–antigen interactions

" The antibody's paratope interacts with the antigen's epitope. An antigen usually contains different epitopes along its surface arranged discontinuously, and dominant epitopes on a given antigen are called determinants.

Antibody and antigen interact by spatial complementarity (lock and key). The molecular forces involved in the Fab-epitope interaction are weak and non-specific – for example electrostatic forces, hydrogen bonds, hydrophobic interactions, and van der Waals forces. This means binding between antibody and antigen is reversible, and the antibody's affinity towards an antigen is relative rather than absolute. Relatively weak binding also means it is possible for an antibody to cross-react with different antigens of different relative affinities."



Antibody tests for this alleged sars-cov-2 virus whose very existence and pathogenicity nobody has proven so far, are a fraud : the alleged spike protein that is supposed to detect antibody response

and thus confirm covid diagnoses is NOT a real protein extracted from live samples of patients : it is a synthetic lab product, made according to a genome formula that was completely made up arbitrarily. So assuming that antibody response to this synthetic lab spike protein, is elicited in the serum or plasma sample, it does NOT mean a patient was infected with any real virus at all - just that his finger prick or serum etc., reacted to an artificial protein thrown into the sample by the tester, not to an alleged virus that does NOT repeat NOT even provably exist :

" Enzyme-linked immunosorbent assay (ELISA)

We used a novel ELISA. Recombinant SARS-CoV-2 trimeric spike protein was constructed,

tagged and purified. Immunoplates coated with StrepMAB-Classic were used to capture

tagged soluble trimeric SARS-CoV-2 trimeric S protein and then incubated with test plasma.

Antibody binding to the S protein was detected with ALP-conjugated anti-human IgG or antihuman

IgM." :

https://www.medrxiv.org/content/10.1101/2020.04.15.20066407v1.full.pdf

Notice how none of this crap has been peer-reviewed - and it never will, for it is absurd and a mockery of science.

https://www.thelancet.com/journals/laninf/article/PIIS1473-3099(20)30787-8/fulltext

https://www.ncbi.nlm.nih.gov/pubmed/32075877

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7164637/

(artificial construction of S-protein from databank genome)

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7094943/

(fan wu et all., alleged sequencing of the alleged sars-cov-2, March 2020)

https://www.ncbi.nlm.nih.gov/nuccore/MN908947

(alleged genomic structure of sars-cov-2 on genebank)

https://en.wikipedia.org/wiki/Human_coronavirus_NL63

(NL63 uses S-protein and ACE2 receptor to enter cells. Just like the sars cov corona and the alleged sars cov 2, and is associated with kawasaki as they are now saying of sars cov 2...)

http://www.iskrae.eu/soldi-interessi-militari-nato-test-sierologici-covid-19-italia/

ANTIGEN TESTS : ANOTHER SCAM

Antigen tests are the opposite of antibody tests : they use allegedly specific antibodies that will bind with virus proteins in your serum if you are infected : trouble is, accuracy is abismally low :

https://www.sciencemag.org/news/2020/05/coronavirus-antigen-tests-quick-and-cheap-too-often-wrong

https://en.joysbio.com/covid-19-antigen-rapid-test-kit/?gclid=EAIaIQobChMIubfE7NXo7AIVGs93Ch1G4go5EAMYAiAAEgKEZ_D_BwE

antigen test using rabbit and chicken antibodies !!!!!!!!!!!

LAMP TESTS : A HOAX

https://en.wikipedia.org/wiki/Loop-mediated_isothermal_amplification

" LAMP is less versatile than PCR, the most familiar nucleic acid amplification technique. LAMP is useful primarily as a diagnostic or detection technique, but is not useful for cloning or many other molecular biology applications enabled by PCR. Because LAMP uses 4 (or 6) primers targeting 6 (or 8) regions within a fairly small segment of the genome, and because primer design is subject to numerous constraints, it is difficult to design primer sets for LAMP "by eye". Free, open-source or commercial software packages are generally used to assist with LAMP primer design, although the primer design constraints mean there is less freedom to choose the target site than with PCR.

In a diagnostic application, this must be balanced against the need to choose an appropriate target (e.g., a conserved site in a highly variable viral genome, or a target that is specific for a particular strain of pathogen). Multiple degenerated sequences may be required to cover the different variant strains of the same species. A consequence of having such a cocktail of primers can be non-specific amplification in the late amplification.

Multiplexing approaches for LAMP are less developed than for PCR. The larger number of primers per target in LAMP increases the likelihood of primer-primer interactions for multiplexed target sets.

SYBR green dye may be added to view LAMP in real-time. However, in the late amplification, primer-dimer amplification may contribute to a false positive signal. Unlike traditional SYBR-green-based PCR assays, a melt curve analysis cannot be performed in LAMP to check for the presence of primer dimers. " :

in short : LAMP testing for covid is yet another dangerous, criminal fraud bound to generate false positives.

This is the accuracy (or the lack thereof) of so-called lateral-flow covid tests, or rapid tests :

https://www.theguardian.com/world/2021/apr/15/what-is-lateral-flow-covid-test-how-accurate

" In a leaked email seen by the Guardian, a senior government official warns that – at the current Covid levels – someone who tests positive with a lateral flow device in London has “at best a 25% chance” of it being a true positive. If the test is taken at home, that falls to as low as 10% or even 2%. Leaked government modelling produced last week suggested that in places where fewer than one in 1,000 people have the disease, the proportion of false positives will outnumber true positives, because there is little virus in circulation. As of last week, overall prevalence in England was 0.12%, while it was 0.04% in London, 0.02% in the south-east and south-west, and 0.08% in the north-east." :

DO NOT REPEAT NOT TAKE ANY COVID TEST AS THEY AMOUNT TO FRAUD - DO NOT TEST FOR A GHOST NEVER EVEN PROVEN TO EXIST TO BEGIN WITH !



CHAPTER 9 : THE VIRUS-SEQUENCING LIE



The chinese stated in their report that they had sequenced the new virus now called sars-cov-2, termed by them 2019-nCoV, by combining (how?) 2 sequencing methods called illumina and nanopore, both of which are highly biased and error-prone :

https://www.nejm.org/doi/full/10.1056/NEJMoa2001017

https://en.wikipedia.org/wiki/Illumina_dye_sequencing

" This piecemeal process allows scientists to see the complete sequence even though an unfragmented sequence was never run; however, because Illumina read lengths are not very long (HiSeq sequencing can produce read lengths around 90 bp long), it can be a struggle to resolve short tandem repeat areas. Also, if the sequence is de novo and so a reference doesn't exist, repeated areas can cause a lot of difficulty in sequence assembly. Additional difficulties include base substitutions (especially at the 3' end of reads) by inaccurate polymerases, chimeric sequences, and PCR-bias, all of which can contribute to generating an incorrect sequence. "

https://en.wikipedia.org/wiki/Nanopore_sequencing

" Notably, theorists have shown that sequencing via exonuclease enzymes as described here is not feasible [Exonucleases are enzymes that work by cleaving nucleotides one at a time from the end (exo) of a polynucleotide chain. A hydrolyzing reaction that breaks phosphodiester bonds at either the 3′ or the 5′ end occurs : https://en.wikipedia.org/wiki/Exonuclease ]. This is mainly due to diffusion related effects imposing a limit on the capture probability of each nucleotide as it is cleaved. This results in a significant probability that a nucleotide is either not captured before it diffuses into the bulk or captured out of order, and therefore is not properly sequenced by the nanopore, leading to insertion and deletion errors. Therefore, major changes are needed to this method before it can be considered a viable strategy.

The use of proteins in biological nanopore sequencing systems, despite the various benefits, also brings with it some negative characteristics. The sensitivity of the proteins in these systems to local environmental stress has a large impact on the longevity of the units, overall. One example is that a motor protein may only unzip samples with sufficient speed at a certain pH range while not operating fast enough outside of the range - this constraint impacts the functionality of the whole sequencing unit. Another example is that a transmembrane porin may only operate reliably for a certain number of runs before it breaks down [Porins are beta barrel proteins that cross a cellular membrane and act as a pore, through which molecules can diffuse : https://en.wikipedia.org/wiki/Porin_(protein) ] . Both of these examples would have to be controlled for in the design of any viable biological nanopore system- something that may be difficult to achieve while keeping the costs of such a technology as low and as competitive, to other systems, as possible.

One challenge for the 'exonuclease approach', where a processive enzyme feeds individual bases, in the correct order, into the nanopore, is to integrate the exonuclease and the nanopore detection systems. In particular, the problem is that when an exonuclease hydrolyzes the phosphodiester bonds between nucleotides in DNA, the subsequently released nucleotide is not necessarily guaranteed to directly move into, say, a nearby alpha-hemolysin nanopore. One idea is to attach the exonuclease to the nanopore, perhaps through biotinylation [biotinylation is the process of covalently attaching biotin, that is vitamin B7, to a protein, nucleic acid or other molecule : https://en.wikipedia.org/wiki/Biotinylation ] to the beta barrel hemolysin [Hemolysins or haemolysins are lipids and proteins that cause lysis of red blood cells by disrupting the cell membrane : https://en.wikipedia.org/wiki/Hemolysin ]. The central pore of the protein may be lined with charged residues arranged so that the positive and negative charges appear on opposite sides of the pore. However, this mechanism is primarily discriminatory and does not constitute a mechanism to guide nucleotides down some particular path. "

https://en.wikipedia.org/wiki/De_novo_sequence_assemblers

" Reads from second generation technologies (called short read technologies) like Illumina are typically short (with lengths of the order of 50-200 base pairs) and have error rates of around 0.5-2%, with the errors chiefly being substitution errors. However, reads from third generation technologies like PacBio and fourth generation technologies like Oxford Nanopore (called long read technologies) are longer with read lengths typically in the thousands or tens of thousands and have much higher error rates of around 10-20% with errors being chiefly insertions and deletions."

https://www.sciencedirect.com/science/article/pii/S0042682219300728

(virus sequencing)

" The bioinformatics analysis of virus sequencing data is often based on alignment, or mapping, of reads against a reference sequence followed by the consensus extraction by majority voting. However, the alignment step is known to introduce some biases (Archer et al., 2010, Posada-Cespedes et al., 2017)⁠. For example, if the studied virus sequence is divergent from the chosen reference sequence, the reads covering the regions of divergence could not be aligned correctly which will bias the resulting consensus. Moreover, the mapping step of reads in divergent, repetitive or low complexity regions is a difficult task which have to be carefully examined (Caboche et al., 2014). Finally, the choice of the reference sequence itself is a critical step from which the resulting consensus sequence will strongly depend."

Let us now break down the lies in one of the original chinese psudoscientific reports about the alleged sequencing of the alleged virus back in january/february 2020 : on such lies passed off as science was the entire scamdemic narrative and the destruction of our freedom based :

https://www.nature.com/articles/s41586-020-2008-3

fan wu febr 3, 2020 sequencing of sars cov 2 from 1 patient !!!

" Here we study a single patient who was a worker at the market and who was admitted to the Central Hospital of Wuhan on 26 December 2019 while experiencing a severe respiratory syndrome that included fever, dizziness and a cough " :

a single patient with ordinary respiratory symptoms ? Now that´s epidemics for you guys !!!

https://academic.oup.com/bib/advance-article/doi/10.1093/bib/bbz155/567891

Number of samples: Selecting a significant sample size remains a key step, especially when the final outcomes are used for clinical settings and interpretations. It has been reported that the microbial load varies between biological replicates existing under similar conditions. This variability between similar samples makes it challenging to identify weak biological signals, especially when the effective size is unknown or small. In most cases, results with small sample sizes do not precisely represent general population-based outcomes. Importantly, sample sizes should always be kept fixed and should not be altered during the study. Hence, choosing appropriate sample sizes based on statistical principles can certainly help to avoid biases and spurious interpretations.

Controls: Controls are needed to identify whether a signal is real and not just a stochastic or spurious result.".

Let us continue with the bogus chinese report :

" Metagenomic RNA sequencing4 of a sample of bronchoalveolar lavage fluid from the patient identified a new RNA virus strain from the family Coronaviridae, which is designated here ‘WH-Human 1’ coronavirus (and has also been referred to as ‘2019-nCoV’)." : REALLY ??

file:///C:/Users/yyy/AppData/Local/Temp/viruses-12-00211.pdf

" there is evidence that metagenomic sequencing is restricted by multiple pitfalls and biases, based on the pathogen’s structure, extraction method, GC content, and other factors. Therefore, there are five major limitations: (1) sequences of interest should share at least low identity with the analogous sequences in a reference genome,ensuring correct mapping;(2) the analytical complexity of obtained data often requires employment of a qualified bioinformatician and the use of a specialized computational infrastructure (including both hardware and software; (3) hidden experimental and methodological prejudices towards certain taxa;(4) defining the method’s sensitivity and properly measuring it against a relevant reference; (5) dealing with the abundance of host-cell, bacterial and fungal nucleic acids. "

On with the chinese scam :

" On the first day of admission (day 6 after the onset of disease), chest radiographs were abnormal with air-space shadowing such as ground-glass opacities, focal consolidation and patchy consolidation in both lungs " : NOTHING ABNORMAL ABOUT ANY OF

THIS !! :

https://link.springer.com/chapter/10.1007/174_2017_151

"The spectrum of morphologic characteristics that are indicative of interstitial lung disease is relatively limited and includes the linear and reticular pattern, the nodular pattern, the increased attenuation pattern (such as ground-glass opacities and consolidation).

The crazy paving pattern is a term reserved for ground-glass opacities with superimposed thickening of the interlobular and intralobular septa.

In addition, patchy ground-glass opacities are present. Acute exacerbation in the same patient shows marked progression of ground-glass opacities.

On HRCT [= High Resoution Computed Tomography] widespread diffuse or patchy ground-glass opacities have been observed in these patients.

On HRCT, NSIP [NonSpecific Interstitial Pneumonia] is characterized by patchy ground-glass opacities combined with irregular linear or reticular opacities (Johkoh et al. 2002).

Axial CT image in a 61-year-old man with NSIP shows bilateral subpleural irregular linear opacities and ground-glass opacities. " :

That is : this alleged wuhan patient had nonspecific interstitial pneumonia, a nonviral disease of likely autoimmune etiology, so y call it "covid" ???

On with the shadow play :

"the patient exhibited respiratory failure and was given high-flow non-invasive ventilation. The condition of the patient did not improve after 3 days of treatment and he was admitted to the intensive care unit. The patient was transferred to another hospital in Wuhan for further treatment 6 days after admission." :

WHAT ON EARTH IS ABNORMAL OR ATYPICAL ABOUT SUCH AN EVENT ?? :

https://link.springer.com/chapter/10.1007/174_2017_151

" Patients with IPF (Idiopathic Pulmonary Fibrosis) may present with rapid respiratory worsening during the course of their disease.

Follow-up CT image obtained after 6 months of corticosteroid therapy shows improvement, with partial resolution of the linear opacities and ground-glass opacities." :

THUS THIS ALLEGED PATIENT HAD EITHER NSIP OR IPF, WHY ONE EARTH CALL SUCH SYMPTOMS OR COURSE OF EVENTS ATYPICAL ? WHY ON EARTH ATRIBUTE IT TO A NOVEL DISEASE ??

On with the china lies :

" Although a combination of antibiotic, antiviral and glucocorticoid therapy was administered, the patient exhibited respiratory failure and was given high-flow non-invasive ventilation. The condition of the patient did not improve after 3 days of treatment and he was admitted to the intensive care unit." :

ABSOLUTELY NONE OF THIS IS VERIFIABLE, AND ANYWAY EVEN IF TRUE, THE PATIENT´S CONDITION MAY WELL HAVE BEEN DUE TO SERIOUS ORDINARY LUNG AILMENTS FEATURING THE EXACT SAME SYMPTOMS AND COMPLICATIONS !!! SOME OF WHICH BY THE WAY, LIKE THE 2 WE SAW ABOVE, ARE SERIOUS TO LETHAL !!! WHY REPACKAGE THEM AS THIS ALLEGED COVID WITH EXACTLY THE SAME SYMPTOMS ???

On with the chinese scammers :

"To investigate the possible aetiological agents associated with this disease, we collected bronchoalveolar lavage fluid (BALF) and performed deep meta-transcriptomic sequencing." :

such sequencing technique is far from reliable !!! :

https://www.sciencedirect.com/science/article/pii/S002203021731175X

" denoising is recommended for QC [Quality Control] of longer sequences generated using Roche/454, PacBio, or Ion Torrent due to their intrinsic errors (error rates of 13% for PacBio and 1.78% for Ion Torrent, and high error rates in homopolymers for Roche/454; Metzker, 2010; Quail et al., 2012; Oulas et al., 2015), which usually lead to errors in regards to “unique” identifiers and reduce the clarity for alignments."

https://genomebiology.biomedcentral.com/articles/10.1186/s13059-019-1659-6

" A typical NGS [Next Generation Sequencing] workflow involves multiple steps prior to sequencing, including sample processing, DNA isolation, and PCR amplification. Errors can be introduced in each of these steps. For example, C>A/G>T errors have been reported to be due to DNA damage during sample processing. Spontaneous deamination of methylated cytosine to uracil can cause C>T/G>A errors. Additional errors can also be introduced by target-enrichment PCR and the sequencing step.

However, despite the significant improvements to overall error rate introduced by removal of LQ[Low Quality]Reads, the A>G/T>C errors remain high. Further enzymatic optimization or DNA repair treatments during library construction might resolve these issues but are out of the scope of this work.

the error rate rarely exceeds 5%. " :

ALWAYS BEAR IN MIND FOR COMPARISON, THAT AN ERROR RATE OF JUST 3% WOULD IDENTIFY YOUR DNA AS THAT OF A CHIMP´S !!!

https://www.nature.com/articles/s41598-019-51470-9

" Depending on the evolutionary history of a given genome, recent paralogous genes can lead to ambiguous alignment when using short reads.

Preparation protocols have a significant impact on the final result as they can incorporate specific biases.

As an example, data produced with protocols based on oligo-dT or random primers in the RT step show differences in how they cover transcripts.

The error rate of ONT reads is still around 10% and complicates the precise detection of splice sites

it has been shown more recently that a software artifact may truncate reads (around 20%) during the base-calling process.

We find that using cDNA-Seq, cDNA molecules stemming from such transcripts are often truncated. This bias is detectable for runs of poly(A) but is much stronger for runs of poly(T).

https://academic.oup.com/bib/advance-article/doi/10.1093/bib/bbz155/5678919

" Nonetheless, there have been concerns about the reproducibility of published microbial sequencing data that consist of large amounts of unknown sequences, also referred to as ‘dark matter’.

Erroneous sample handling, variation in sampling size, choice of DNA extraction methods, as well as computational analyses (e.g. quality filtering tools and assemblers) might lead to inconsistent results. In addition, the lack of standardization of laboratory and computational protocols introduces various biases, which then might lead to non-comparable results.

Despite the recent advancements in sequencing technologies and computational analysis tools, many factors might lead to biases and errors. These errors and biases could be broadly classified into experimental and computational challenges."

https://www.sciencedirect.com/science/article/pii/S1198743X1730575X

(study from 2017/2018) :

" Because of the nature of the semiconductor sequencing, the IonTorrent platform has a high error rate in base calls in long homopolymer regions.

Pacific BioSciences

PacBio RSII 0.5–1b

Up to 60 kb Read length, speed High error rate and initial

Sequel 5–10b

Up to 60 kb Read length, speed High error rate

Oxford Nanopore

MInION 0.1–1 Up to 100 kb Read length, portability High error rate, run length,

increased error rate (increased proportion of reads containing errors among all reads) which in turn results in false-positive variant calling.

MinION is the first commercial sequencing platform using Nanopore technology. It identifies DNA bases by measuring changes in electric conductivity generated as DNA strands pass through a biological pore. The read-length profile of MinION is very similar to that of PacBio but the error rate is even higher (12%–38%)

It is a challenge that the comparability of the sequence data generated on different platforms with different error profiles using different library preparation methods has still not been comprehensively assessed and validated. Only a handful of studies with a limited number of species, isolates and analysis methods have been performed. Systematic studies that include strain identification, characterization and subtyping by both hqSNP and cg/wgMLST are badly needed. Internationally agreed standards for sequence and analysis quality, and data interpretation for clinical, public health and regulatory action are currently missing for most applications and must be developed."

https://www.biorxiv.org/content/10.1101/2019.12.20.871939v2.full

(nanopore error rate : study from 2019/2020) :

" Despite the advances due to deep learning based basecalling, the error rate of basecalled nanopore reads is still around 10%, with a significant fraction of insertion and deletion errors " :

WELL, SUCH IS THE SEQUENCING METHOD USED BY THESE CHINESE SCAMMERS ON PIG PHARM´S PAYROLL TO "SEQUENCE" THE ALLEGED SARS COV 2 VIRUS : IT HAS A 10% ERROR RATE !!!

I REPEAT FOR CLARITY AND REFERENCE : BY AN ERROR RATE OF JUST 3%, YOUR DNA SEQUENCE WOULD IDENTIFY YOU AS A CHIMP !!!

https://www.ukcolumn.org/article/covid-19-hoax

http://philosophers-stone.info/wp-content/uploads/2020/11/The-scam-has-been-confirmed-Dsalud-November-2020.pdf

https://www.youtube.com/watch?v=Q2D-CApMXqY

Here's the real science:

https://www.youtube.com/playlist?list=PLaeD5s4iY6U1f0HSDQNULt-nCZXAxN-nI

And here:

https://andrewkaufmanmd.com/sovi



CHAPTER 10 : SAY NO TO THIS VAXIS OF EVIL !!!



THERE IS NO SARS-COV-2 virus no covid disease no pandemic it´s all a pharmanazi hoax for profit :

Here's the real science:

https://www.youtube.com/playlist?list=PLaeD5s4iY6U1f0HSDQNULt-nCZXAxN-nI

And here:

https://andrewkaufmanmd.com/sovi

https://www.brighteon.com/b530cbc6-a29a-4d50-bdc9-cd61213edec2

(no official record of virus isolation in UK)

https://www.fluoridefreepeel.ca/?s=covid

(no official records of sars cov 2 isolation)

https://www.lewrockwell.com/2020/12/jon-rappoport/the-sars-cov-2-virus-was-never-proved-to-exist/

https://wissenschafftplus.de/uploads/article/wissenschafftplus-fehldeutung-virus-teil-2.pdf

https://off-guardian.org/2020/06/27/covid19-pcr-tests-are-scientifically-meaningless/

https://www.youtube.com/watch?v=6ny9nNFHQsY

https://www.youtube.com/watch?v=xFwqArvB1IM

https://la.indymedia.org/news/2020/05/299370.php

http://theinfectiousmyth.com/coronavirus/AntibodyTestingForCOVID.pdf https://twitter.com/DavidRCrowe

https://www.youtube.com/watch?v=NYr2jJf-zZ0&t=187s https://blog.nomorefakenews.com/2018/04/04/the-gold-standard-of-medical-tests-is-fake/

https://theinfectiousmyth.com/book/CoronavirusPanic.pdf

https://theinfectiousmyth.com/coronavirus/EvidenceExistenceCOVID19Corbett.pdf

https://theinfectiousmyth.com/coronavirus/RT-PCR_Test_Issues.php

https://lockdownsceptics.org/the-incredible-and-scary-truth-about-covid-19-tests-2/

https://twitter.com/InfectiousMyth/status/1250138967799779328

https://www.projectveritas.com/

https://www.youtube.com/watch?v=o7A_cMpKm6w&t=5s https://www.youtube.com/watch?v=yaOvva72b7o

https://uncoverdc.com/2020/04/07/was-the-covid-19-test-meant-to-detect-a-virus/ https://www.youtube.com/watch?v=Ygms5aBiQQ8

https://www.regenbogenkreis.de/blog/gesundheit-und-ernaehrung/coronavirus-inszenierte-panikmache

https://www.nogeoingegneria.com/uncategorized/tempo-di-coronavirus-essere-critici-e-permesso/

https://www.wodarg.com/

https://pubmed.ncbi.nlm.nih.gov/32133832/

https://www.youtube.com/watch?v=92pPKqGnt8k

(google function on everybody´s smartphones : " notice of exposure to covid" : so if you don´t download their tracing apps, they´ll trace you and control you and blackmail you anyway, under permanent threat of quarantine, isolation, lockdown, forced sanitary treatment, psychiatric ward if you resist etc. : THROW AWAY YOUR SMARTPHONE NOW !!! )

https://www.ospfe.it/area-comunicazione/news/dal-27-maggio-tampone-a-tutti-i-pazienti-in-attesa-di-ricovero

(compulsory "covid"-test swab for all patients awaiting surgery : forced sanitary treatment : auschwitz : all of which, over an alleged disease that DOES NOT EXIST !!

https://www.youtube.com/watch?v=_v2XWuPY09M

https://drive.google.com/file/d/1S7xW72ahs7Guqo7JzzPFuI0P6wjg_j5r/view

https://lockdownsceptics.org/testing-do-you-have-the-disease/#comment-402

https://truthiverse.com/2

https://fakeologist.com/

http://fakeologist.com/corona-main/corona-2/

http://fakeologist.com/blog/2020/08/06/looking-for-the-key-to-destroy-the-entire-coronavirushoax/

https://www.youtube.com/watch?v=_dKFI4DHzzQ

https://www.facebook.com/VirusManiaBook

https://www.bmj.com/rapid-response/2011/10/28/does-hiv-exist

http://civilizationis.com/aids/hivexist/index.htm

https://onlinelibrary.wiley.com/doi/full/10.1111/eci.12801

https://aru.ac.uk/people/stephen-bustin

Bill gates and his lackeys the world over are trying to use this false pretext to turn us all into their transhumanistic robotic slaves :

bill gates using poor Indian girls as guinea pigs for his vaccine trials :

https://ijme.in/articles/deaths-in-a-trial-of-the-hpv-vaccine/?galley=html

https://www.ecchr.eu/en/case/indian-supreme-court-asks-pharmaceutical-companies-for-specific-details-on-clinical-trials/

...and American teens as well :

https://nationalfile.com/15-year-old-boy-dies-of-heart-attack-two-days-after-taking-pfizer-vaccine-had-no-history-of-allergic-reactions/

bill gates is a pervert and a pig :

https://www.nytimes.com/2021/05/16/business/bill-melinda-gates-divorce-epstein.html?action=click&module=Top%20Stories&pgtype=Homepage

I would like to try and explain the fraudulent science behind these absurd "covid" vaccines. Bear with me just a bit. Moderna´s and pfizer´s - that is, robert kapito´s and larry fink´s - vaxes are not traditional vaccines made of attenuated virus. That means, they reportedly contain no killed or neutralized virus that would then stimulate antibody response from our immune systems. Reason y kapito and fink didn´t even try to invest in a traditional attenuated-virus vax is - the sars cov 2 virus does not repeat NOT exist so they simply did not have it :

" But once the sequence was in the public realm, Moderna, an obscure biotech company in Cambridge, Mass., immediately began working with the National Institutes of Health on a plan. “They never had the virus on site at all; they really just used the sequence, and they viewed it as a software problem,” Francis deSouza, the chief executive of Illumina, which makes the sequencer that Zhang used, told me with some amazement last summer, six months before the Moderna vaccine received an emergency-use authorization by the Food and Drug Administration." :

https://www.nytimes.com/interactive/2021/03/25/magazine/genome-sequencing-covid-variants.html?action=click&module=Top%20Stories&pgtype=Homepage

NOW : HOW COULD MODERNA, OR PFIZER OR ANY OTHER VAX MAKER, POSSIBLY TEST THE EFFICACY OF THEIR VAX AT ALL, WITHOUT HAVING THE LIVE VIRUS TO INCOULATE INTO VACCINATED TEST ANIMALS ???? THIS DAMNING REPORT BY DE SOUZA IS THE ULTIMATE PROOF THAT THESE SO-CALLED COVID VAXES HAVE NOT BEEN TESTED AT ALL !!! AND THAT THE VIRUS DOES NOT EXIST EXCEPT AS A FAKE FORMULA IN A DATABANK !!! HOW COULD ANY VAX MAKER WORTH ITS NAME NOT WANT TO VERIFY AND CONFIRM THE EXISTENCE AND SEQUENCING OF AN ALLEGED NEW VIRUS THEY HAVE ONLY READ ABOUT IN A TWEET ??? HOW COULD THEY POSSIBLY BE CLAIMING VAX SAFETY AND EFFICACY BASED ON A SOFTWARE ALGORITHM ??? THESE VAXES ARE ALL ABOUT GENETIC ENGINEERING OF THE HEALTHY AND MASSMURDERING THE WEAK AND ILL !!! HITLER´S EUTHANASIA ALL OVER AGAIN BUT ON A GLOBAL SCALE !!! SAY NO !!!

THE SAME THING HAPPENED WITH THE JENNER/OXFORD/ASTRAZENECA "SCIENTISTS" WHO MADE THAT PARTICULAR POISON JAB : THEY DESIGNED THEIR VAX BASED ON A CHINESE SEQUENCE SENT TO THEM BY EMAIL !!!!!!!!!!!!!! WITHOUT EVEN BOTHERING TO VERIFY WHETHER OR NOT THE VIRUS EXISTED AT ALL OR WHETHER THAT SEQUENCE WAS CORRECT !!!!!!!!! :

https://www.theguardian.com/society/2021/aug/28/oral-history-of-oxfordastrazeneca-making-a-vaccine-in-a-year-is-like-landing-a-human-on-the-moon

" On 11 January 2020 [a Saturday], media reported the first death from what would come to be known as Sars-CoV-2, or Covid-19. The same day, Chinese virologist Zhang Yongzhen published the genome sequence of the virus online. Lambe received the genome in her email inbox early Saturday morning.

Lambe We knew it was coming, and we’d already had a discussion about what to do. We designed [the vaccine] over that weekend. "

[Teresa Lambe, associate professor, Jenner Institute, is a member of the astrazeneca team of "scientists"] :

JUST HOW DID THEY KNOW IT WAS COMING ? CRYSTAL BALL OR WHAT ? WHAT SCIENTIST IN THEIR SANE MIND WOULD BOTHER DESIGNING A VAX AT LIGHTNING SPEED OVER 1 SINGLE DEATH - THAT IS, AS OF JANUARY 11, 2021, OVER NO EPIDEMIC AND NO PANDEMIC AT ALL ???

NONE OF THESE MENGELES EVER SAW THE ALLEGED SARS COV 2 VIRUS !!! NONE OF THEM EVER BOTHERED TO ISOLATE IT OR SEQUENCE IT OR ASCERT ITS PATHOGENICITY BY INJECTING IT INTO ANIMALS, TEST TRIAL CELL LINES ETC. !!!

AN UTTER MOCKERY OF SCIENCE !!! THIS VAX HAS NOTHING WHATSOEVER TO DO WITH THIS ARCHFAKE VIRUS, THIS VAX HAD BEEN READY FOR MONTHS IF NOT YEARS AS AN EXPERIMENT IN GENETIC REENGINEERING OF MANKIND AND GENOCIDING THE WEAK INFIRM AND IMMUNOCOMPROMISED - A GRAND REEDITION OF HITLER´S EUTHANASIA PROGRAM ON A GLOBAL SCALE !!! PLUS OF COURSE, THE HUGE PROFIT MOTIVE FOR PIG PHARM´S OWNERS, CHIEF AMONG THEM GLOBALIST USURERS LAURENCE FINK AND ROBER KAPITO OF BLACKROCK INVESTMENT FUND !!! PHARMANAZI CRIMINALS AGAINST HUMANITY !!!

DON´T BE FOOLED WHEN THE SPONSORED ARTICLE LINKED HAS THESE "SCIENTISTS" FROM OXFORD STATE THEY DID TEST-TRY THEIR VAX ON MONKEYS, CELL LINES AND HUMANS BEFORE ROLLOUT : WHAT THEY DID TEST-TRY, IN AN ABSURDLY SHORT TIME SPAN AND WITHOUT EVEN WAITING FOR THE RESULTS AS THEY THEMSELVES ADMIT, WAS INOCULATING INTO ANIMALS ETC., AN ALLEGED SPIKE SEQUENCE THAT DID NOT COME FROM A LIVE VIRUS THEY NEVER HAD, BUT INSTEAD, WAS MANUFACTURED BY THEM IN THE LAB ACCORDING TO AN ALLEGED CHINESE SEQUENCING THEY HAD RECEIVED BY EMAIL AND NEVER BOTHERED TO VERIFY !!!!

https://www.theguardian.com/society/2021/aug/28/oral-history-of-oxfordastrazeneca-making-a-vaccine-in-a-year-is-like-landing-a-human-on-the-moon

AGAIN AND AGAIN : THE VAX MANUFACTURERS THEMSELVES, ALL OF THEM, NEVER EVER SAW THIS ARCHFAKE VIRUS, NEVER EVER ISOLATED IT, NEVER EVER CULTURED IT, NEVER EVER VERIFIED ITS EXISTENCE AND PATHOGENICITY - NOBODY IN THE WORLD DID THIS, NO LAB IN THE WORLD HAS THIS GHOST VIRUS, NOT EVEN THE US CDC, IT JUST PLAIN AND SIMPLY DOES NOT REPEAT NOT EXIST IT´S ALL A MASSIVE PHARMANAZI PSYOP FOR PROFIT AND RENAZIFICATION OF MANKIND SAY NO !!!!!!!!

There is not one shred of serious scientific evidence that the sars cov 2 virus exist, let alone the disease covid and its pandemic. These new vaxes are mRNA - based. mRNA, or messenger RNA is a part of our genomic matter, encoding the necessary genetic information for our cells to make proteins. But moderna´s and the rest of these "covid" vaxes are NOT made of natural mRNA : instead, those thugs have reportedly synthesized chemical mRNA in their labs, programming it in such a way, that it would theoretically encode instructions for our cells to produce the S or spike protein of this alleged sars cov 2 virus allegedly causing the alleged covid disease . But kapito and fink have released the alleged genome sequence of the alleged S protein they are allegedly coding us for : every single type of coronavirus features the spike protein. They are saying, we worked based on databank genomes - there´s tens of thousands of them alleged sars cov 2 genomes in the databanks, so what exactly are we talking about here ?

How could these unverified, unverifiable vaxes be approved at all ? What is the sense of a vaccine against a virus that doesn´t exist ? What is the sense of teaching our bodies to make a pathogen such as the S protein ? Y make us ill with chemical stuff only to then stimulate unnatural, unnecessary antibody response and mess up our immune system ? DO NOT TAKE THESE VACCINES : THIS IS A NAZI EXPERIMENT ON A PLANETARY SCALE : TOMORROW WITH THE EXCUSE OF THE NEXT FAKE PANDEMIC THEY MIGHT BY THE SAME TOKEN, FORCE US TO TAKE INJECTIONS CONTAINING INSTRUCTIONS TO BLINDLY OBEY ANY ORDER THEY MIGHT WANT TO GIVE US.

https://www.technologyreview.com/2020/12/09/1013538/what-are-the-ingredients-of-pfizers-covid-19-vaccine/

" But Pfizer is holding back a little. The spike gene sequence can be tweaked in small ways for better performance, by means that include swapping letters. We don’t think Pfizer has said exactly what sequence it is using, or what modified nucleosides. That means the content of the shot may not be 100% public."

Definitive proof that pfizer and the rest of them mengeles and their globalist-usurer puppeteers have been using alleged spike sequences in their vaxes that had been readied from months and years before 2020, that have NOTHING to do with any nonexistent, empirically observed virus, that have NOTHING to do even with the published, archfake chinese sequencing they say they based their vax on, is as follows : this is supposed to be the original chinese spike-protein sequence for the sars cov 2 virus that the vax makers state they based their vaxes on : I´ll first paste the translated sequence, that is the final state of the protein expressed in aminoacids :

https://www.ncbi.nlm.nih.gov/sars-cov-2/

click on sequence record :

https://www.ncbi.nlm.nih.gov/nuccore/NC_045512

(sars cov 2 wuhan 1 sequence) :

translated spike sequence :

"MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFR

SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIR

GWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVY

SSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQ

GFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFL

LKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITN

LCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCF

TNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYN

YLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPY

RVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFG

RDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAI

HADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR

RARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTM

YICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFG

GFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFN

GLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQN

VLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALNTLVKQLSSNFGA

ISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMS

ECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAH

FPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELD

SFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELG

KYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSE

PVLKGVKLHYT"

But in order to compare this wuhan spike with pfizer´s, we need to first backtranslate its sequence into the original nucleotide sequence it is derived from, because our genome produces protein according to a nucleotide code which it then processes into aminoacids:

https://www.genome.gov/genetics-glossary/Translation

Therefore :

https://www.ebi.ac.uk/Tools/st/emboss_backtranseq/

I entered the translated wuhan S above and got this as backtranslation into likely original nucleotide sequence :

https://www.ebi.ac.uk/Tools/services/web/toolresult.ebi?jobId=emboss_backtranseq-I20211008-225909-0146-2654289-p1m

ATGTTCGTGTTCCTGGTGCTGCTGCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACC

AGGACCCAGCTGCCCCCCGCCTACACCAACAGCTTCACCAGGGGCGTGTACTACCCCGAC

AAGGTGTTCAGGAGCAGCGTGCTGCACAGCACCCAGGACCTGTTCCTGCCCTTCTTCAGC

AACGTGACCTGGTTCCACGCCATCCACGTGAGCGGCACCAACGGCACCAAGAGGTTCGAC

AACCCCGTGCTGCCCTTCAACGACGGCGTGTACTTCGCCAGCACCGAGAAGAGCAACATC

ATCAGGGGCTGGATCTTCGGCACCACCCTGGACAGCAAGACCCAGAGCCTGCTGATCGTG

AACAACGCCACCAACGTGGTGATCAAGGTGTGCGAGTTCCAGTTCTGCAACGACCCCTTC

CTGGGCGTGTACTACCACAAGAACAACAAGAGCTGGATGGAGAGCGAGTTCAGGGTGTAC

AGCAGCGCCAACAACTGCACCTTCGAGTACGTGAGCCAGCCCTTCCTGATGGACCTGGAG

GGCAAGCAGGGCAACTTCAAGAACCTGAGGGAGTTCGTGTTCAAGAACATCGACGGCTAC

TTCAAGATCTACAGCAAGCACACCCCCATCAACCTGGTGAGGGACCTGCCCCAGGGCTTC

AGCGCCCTGGAGCCCCTGGTGGACCTGCCCATCGGCATCAACATCACCAGGTTCCAGACC

CTGCTGGCCCTGCACAGGAGCTACCTGACCCCCGGCGACAGCAGCAGCGGCTGGACCGCC

GGCGCCGCCGCCTACTACGTGGGCTACCTGCAGCCCAGGACCTTCCTGCTGAAGTACAAC

GAGAACGGCACCATCACCGACGCCGTGGACTGCGCCCTGGACCCCCTGAGCGAGACCAAG

TGCACCCTGAAGAGCTTCACCGTGGAGAAGGGCATCTACCAGACCAGCAACTTCAGGGTG

CAGCCCACCGAGAGCATCGTGAGGTTCCCCAACATCACCAACCTGTGCCCCTTCGGCGAG

GTGTTCAACGCCACCAGGTTCGCCAGCGTGTACGCCTGGAACAGGAAGAGGATCAGCAAC

TGCGTGGCCGACTACAGCGTGCTGTACAACAGCGCCAGCTTCAGCACCTTCAAGTGCTAC

GGCGTGAGCCCCACCAAGCTGAACGACCTGTGCTTCACCAACGTGTACGCCGACAGCTTC

GTGATCAGGGGCGACGAGGTGAGGCAGATCGCCCCCGGCCAGACCGGCAAGATCGCCGAC

TACAACTACAAGCTGCCCGACGACTTCACCGGCTGCGTGATCGCCTGGAACAGCAACAAC

CTGGACAGCAAGGTGGGCGGCAACTACAACTACCTGTACAGGCTGTTCAGGAAGAGCAAC

CTGAAGCCCTTCGAGAGGGACATCAGCACCGAGATCTACCAGGCCGGCAGCACCCCCTGC

AACGGCGTGGAGGGCTTCAACTGCTACTTCCCCCTGCAGAGCTACGGCTTCCAGCCCACC

AACGGCGTGGGCTACCAGCCCTACAGGGTGGTGGTGCTGAGCTTCGAGCTGCTGCACGCC

CCCGCCACCGTGTGCGGCCCCAAGAAGAGCACCAACCTGGTGAAGAACAAGTGCGTGAAC

TTCAACTTCAACGGCCTGACCGGCACCGGCGTGCTGACCGAGAGCAACAAGAAGTTCCTG

CCCTTCCAGCAGTTCGGCAGGGACATCGCCGACACCACCGACGCCGTGAGGGACCCCCAG

ACCCTGGAGATCCTGGACATCACCCCCTGCAGCTTCGGCGGCGTGAGCGTGATCACCCCC

GGCACCAACACCAGCAACCAGGTGGCCGTGCTGTACCAGGACGTGAACTGCACCGAGGTG

CCCGTGGCCATCCACGCCGACCAGCTGACCCCCACCTGGAGGGTGTACAGCACCGGCAGC

AACGTGTTCCAGACCAGGGCCGGCTGCCTGATCGGCGCCGAGCACGTGAACAACAGCTAC

GAGTGCGACATCCCCATCGGCGCCGGCATCTGCGCCAGCTACCAGACCCAGACCAACAGC

CCCAGGAGGGCCAGGAGCGTGGCCAGCCAGAGCATCATCGCCTACACCATGAGCCTGGGC

GCCGAGAACAGCGTGGCCTACAGCAACAACAGCATCGCCATCCCCACCAACTTCACCATC

AGCGTGACCACCGAGATCCTGCCCGTGAGCATGACCAAGACCAGCGTGGACTGCACCATG

TACATCTGCGGCGACAGCACCGAGTGCAGCAACCTGCTGCTGCAGTACGGCAGCTTCTGC

ACCCAGCTGAACAGGGCCCTGACCGGCATCGCCGTGGAGCAGGACAAGAACACCCAGGAG

GTGTTCGCCCAGGTGAAGCAGATCTACAAGACCCCCCCCATCAAGGACTTCGGCGGCTTC

AACTTCAGCCAGATCCTGCCCGACCCCAGCAAGCCCAGCAAGAGGAGCTTCATCGAGGAC

CTGCTGTTCAACAAGGTGACCCTGGCCGACGCCGGCTTCATCAAGCAGTACGGCGACTGC

CTGGGCGACATCGCCGCCAGGGACCTGATCTGCGCCCAGAAGTTCAACGGCCTGACCGTG

CTGCCCCCCCTGCTGACCGACGAGATGATCGCCCAGTACACCAGCGCCCTGCTGGCCGGC

ACCATCACCAGCGGCTGGACCTTCGGCGCCGGCGCCGCCCTGCAGATCCCCTTCGCCATG

CAGATGGCCTACAGGTTCAACGGCATCGGCGTGACCCAGAACGTGCTGTACGAGAACCAG

AAGCTGATCGCCAACCAGTTCAACAGCGCCATCGGCAAGATCCAGGACAGCCTGAGCAGC

ACCGCCAGCGCCCTGGGCAAGCTGCAGGACGTGGTGAACCAGAACGCCCAGGCCCTGAAC

ACCCTGGTGAAGCAGCTGAGCAGCAACTTCGGCGCCATCAGCAGCGTGCTGAACGACATC

CTGAGCAGGCTGGACAAGGTGGAGGCCGAGGTGCAGATCGACAGGCTGATCACCGGCAGG

CTGCAGAGCCTGCAGACCTACGTGACCCAGCAGCTGATCAGGGCCGCCGAGATCAGGGCC

AGCGCCAACCTGGCCGCCACCAAGATGAGCGAGTGCGTGCTGGGCCAGAGCAAGAGGGTG

GACTTCTGCGGCAAGGGCTACCACCTGATGAGCTTCCCCCAGAGCGCCCCCCACGGCGTG

GTGTTCCTGCACGTGACCTACGTGCCCGCCCAGGAGAAGAACTTCACCACCGCCCCCGCC

ATCTGCCACGACGGCAAGGCCCACTTCCCCAGGGAGGGCGTGTTCGTGAGCAACGGCACC

CACTGGTTCGTGACCCAGAGGAACTTCTACGAGCCCCAGATCATCACCACCGACAACACC

TTCGTGAGCGGCAACTGCGACGTGGTGATCGGCATCGTGAACAACACCGTGTACGACCCC

CTGCAGCCCGAGCTGGACAGCTTCAAGGAGGAGCTGGACAAGTACTTCAAGAACCACACC

AGCCCCGACGTGGACCTGGGCGACATCAGCGGCATCAACGCCAGCGTGGTGAACATCCAG

AAGGAGATCGACAGGCTGAACGAGGTGGCCAAGAACCTGAACGAGAGCCTGATCGACCTG

CAGGAGCTGGGCAAGTACGAGCAGTACATCAAGTGGCCCTGGTACATCTGGCTGGGCTTC

ATCGCCGGCCTGATCGCCATCGTGATGGTGACCATCATGCTGTGCTGCATGACCAGCTGC

TGCAGCTGCCTGAAGGGCTGCTGCAGCTGCGGCAGCTGCTGCAAGTTCGACGAGGACGAC

AGCGAGCCCGTGCTGAAGGGCGTGAAGCTGCACTACACC

Now : the alleged sequence of the mRNA in the pfizer "vaccine" has been published and here it is :

https://web.archive.org/web/20210105162941/https://mednet-communities.net/inn/db/media/docs/11889.doc

(wait for microsoft to open window and click open) :

(I had to replace all PSI´s with U, I´ll explain y in the chapter "Alphabet soup" below) :

AACCUGACCACCAGAACACAGCUGCCUCCAGCCUACACCAACAGCUUUACCAGAGGCGUGUACUACCCCGACAAGGUGUUCAGAUCCAGCGUGCUGCACUCUACCCAGGACCUGUUCCUGCCUUUCUUCAGCAACGUGACCUGGUUCCACGCCAUCCACGUGUCCGGCACCAAUGGCACCAAGAGAUUCGACAACCCCGUGCUGCCCUUCAACGACGGGGUGUACUUUGCCAGCACCGAGAAGUCCAACAUCAUCAGAGGCUGGAUCUUCGGCACCACACUGGACAGCAAGACCCAGAGCCUGCUGAUCGUGAACAACGCCACCAACGUGGUCAUCAAAGUGUGCGAGUUCCAGUUCUGCAACGACCCCUUCCUGGGCGUCUACUACCACAAGAACAACAAGAGCUGGAUGGAAAGCGAGUUCCGGGUGUACAGCAGCGCCAACAACUGCACCUUCGAGUACGUGUCCCAGCCUUUCCUGAUGGACCUGGAAGGCAAGCAGGGCAACUUCAAGAACCUGCGCGAGUUCGUGUUUAAGAACAUCGACGGCUACUUCAAGAUCUACAGCAAGCACACCCCUAUCAACCUCGUGCGGGAUCUGCCUCAGGGCUUCUCUGCUCUGGAACCCCUGGUGGAUCUGCCCAUCGGCAUCAACAUCACCCGGUUUCAGACACUGCUGGCCCUGCACAGAAGCUACCUGACACCUGGCGAUAGCAGCAGCGGAUGGACAGCUGGUGCCGCCGCUUACUAUGUGGGCUACCUGCAGCCUAGAACCUUCCUGCUGAAGUACAACGAGAACGGCACCAUCACCGACGCCGUGGAUUGUGCUCUGGAUCCUCUGAGCGAGACAAAGUGCACCCUGAAGUCCUUCACCGUGGAAAAGGGCAUCUACCAGACCAGCAACUUCCGGGUGCAGCCCACCGAAUCCAUCGUGCGGUUCCCCAAUAUCACCAAUCUGUGCCCUUCGGCGAGGUGUUCAAUGCCACCAGAUUCGCCUCUGUGUACGCCUGGAACCGGAAGCGGAUCAGCAAUUGCGUGGCCGACUACUCCGUGCUGUACAACUCCGCCAGCUUCAGCACCUUCAAGUGCUACGGCGUGUCCCCUACCAAGCUGAACGACCUGUGCUUCACAAACGUGUACGCCGACAGCUUCGUGAUCCGGGGAGAUGAAGUGCGGCAGAUUGCCCCUGGACAGACAGGCAAGAUCGCCGACUACAACUACAAGCUGCCCGACGACUUCACCGGCUGUGUGAUUGCCUGGAACAGCAACAACCUGGACUCCAAAGUCGGCGGCAACUACAAUUACCUGUACCGGCUGUUCCGGAAGUCCAAUCUGAAGCCCUUCGAGCGGGACAUCUCCACCGAGAUCUAUCAGGCCGGCAGCACCCCUUGUAACGGCGUGGAAGGCUUCAACUGCUACUUCCCACUGCAGUCCUACGGCUUUCAGCCCACAAAUGGCGUGGGCUAUCAGCCCUACAGAGUGGUGGUGCUGAGCUUCGAACUGCUGCAUGCCCCUGCCACAGUGUGCGGCCCUAAGAAAAGCACCAAUCUCGUGAAGAACAAAUGCGUGAACUUCAACUUCAACGGCCUGACCGGCACCGGCGUGCUGACAGAGAGCAACAAGAAGUUCCUGCCAUUCCAGCAGUUUGGCCGGGAUAUCGCCGAUACCACAGACGCCGUUAGAGAUCCCCAGACACUGGAAAUCCUGGACAUCACCCCUUGCAGCUUCGGCGGAGUGUCUGUGAUCACCCCUGGCACCAACACCAGCAAUCAGGUGGCAGUGCUGUACCAGGACGUGAACUGUACCGAAGUGCCGUGGCCAUUCACGCCGAUCAGCUGACACCUACAUGGCGGGUGUACUCCACCGGCAGCAAUGUGUUUCAGACCAGAGCCGGCUGUCUGAUCGGAGCCGAGCACGUGAACAAUAGCUACGAGUGCGACAUCCCCAUCGGCGCUGGAAUCUGCGCCAGCUACCAGACACAGACAAACAGCCCUCGGAGAGCCAGAAGCGUGGCCAGCCAGAGCAUCAUUGCCUACACAAUGUCUCUGGGCGCCGAGAACAGCGUGGCCUACUCCAACAACUCUAUCGCUAUCCCCACCAACUUCACCAUCAGCGUGACCACAGAGAUCCUGCCUGUGUCCAUGACCAAGACCAGCGUGGACUGCACCAUGUACAUCUGCGGCGAUUCCACCGAGUGCUCCAACCUGCUGCUGCAGUACGGCAGCUUCUGCACCCAGCUGAAUAGAGCCCUGACAGGGAUCGCCGUGGAACAGGACAAGAACACCCAAGAGGUGUUCGCCCAAGUGAAGCAGAUCUACAAGACCCCUCCUAUCAAGGACUUCGGCGGCUUCAAUUUCAGCCAGAUUCUGCCCGAUCCUAGCAAGCCCAGCAAGCGGAGCUUCAUCGAGGACCUGCUGUUCAACAAAGUGACACUGGCCGACGCCGGCUUCAUCAAGCAGUAUGGCGAUUGUCUGGGCGACAUUGCCGCCAGGGAUCUGAUUUGCGCCCAGAAGUUUAACGGACUGACAGUGCUGCCUCCUCUGCUGACCGAUGAGAUGAUCGCCCAGUACACAUCUGCCCUGCUGGCCGGCACAAUCACAAGCGGCUGGACAUUUGGAGCAGGCGCCGCUCUGCAGAUCCCCUUUGCUAUGCAGAUGGCCUACCGGUUCAACGGCAUCGGAGUGACCCAGAAUGUGCUGUACGAGAACCAGAAGCUGAUCGCCAACCAGUUUCAACAGCGCCAUCGGCAAGAUCCAGGACAGCCUGAGCAGCACAGCAAGCGCCCUGGGAAAGCUGCAGGACGUGGUCAACCAGAAUGCCCAGGCACUGAACACCCUGGUCAAGCAGCUGUCCUCCAACUUCGGCGCCAUCAGCUCUGUGCUGAACGAUAUCCUGAGCAGACUGGACCCUCCUGAGGCCGAGUGCAGAUCGACAGACUGAUCACAGGCAGACUGCAGAGCCUCCAGACAUACGUGACCCAGCAGCUGAUCAGAGCCGCCGAGAUUAGAGCCUCUGCAAUCUGGCCGCCACCAAGAUGUCUGAGUGUGUGCUGGGCCAGAGCAAGAGAGTGGACUUUUGCGGCAAGGGCUACCACCUGAUGAGCUUCCCUCAGUCUGCCCCUCACGGCGUGGUGUUUCUGCACGUGACAUAUGUGCCCGCUCAAGAGAAGAAUUUCACCACCGCUCCAGCCAUCUGCCACGACGGCAAAGCCCACUUUCCUAGAGAAGGCGUGUUCGUGUCCAACGGCACCCAUUGGUUCGUGACACAGCGGAACUUCUACGAGCCCCAGAUCAUCACCACCGACAACACCUUCGUGUCUGGCAACUGCGACGUCGUGAUCGGCAUUGUGAACAAUACCGUGUACGACCCUCUGCAGCCCGAGCUGGACAGCUUCAAAGAGGAACUGGACAAGUACUUUAAGAACCACACAAGCCCCGACGUGGACCUGGGCGAUAUCAGCGGAAUCAAUGCCAGCGUCGUGAACAUCCAGAAAGAGAUCGACCGGCUGAACGAGGUGGCCAAGAAUCUGAACGAGAGCCUGAUCGACCUGCAAGAACUGGGGAAGUACGAGCAGUACAUCAAGUGGCCCUGGUACAUCUGGCUGGGCUUUAUCGCCGGACUGAUUGCCAUCGUGAUGGUCACAAUCAUGCUGUGUUGCAUGACCAGCUGCUGUAGCUGCCUGAAGGGCUGUUGUAGCUGUGGCAGCUGCUGCAAGUUCGACGAGGACGAUUCUGAGCCCGUGCUGAAGGGCGUGAAACUGCACUACACAUGAUGA

So this was pfizer´s mRNA sequence in the vax for the alleges S protein of the alleged sars cov 2 virus ; and pfizer stated, as we saw above, just like all other vax manufacturers, that they used the wuhan sequence : let us verify whether it´s true or not :

Now I´ll paste the first wuhan S sequence line, and beneath it for comparison, the first pfizer line :

wuhan S :

(T in DNA is the equivalent of U in RNA, so never mind that now, they are interchangeable and irrelevant as to sequence order, it´s just that some databases prefer to always

use T even when they describe RNA sequences) :

ATGTTCGTGTTCCTGGTGCTGCTGCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACC

pfizer S :

AACCUGACCACCAGAACACAGCUGCCUCCAGCCUACACCAACAGCUUUACCAGAGGCGUGUACUAC

they have nothing whatsoever to do with each other !!!

I´ll now proceed to make that even clearer by replacing all U´s in pfizer´s sequence with T´s like in wuhan´s :

PFIZER :

AACCTGACCACCAGAACACAGCTGCCTCCAGCCTACACCAACAGCTTTACCAGAGGCGTGTACTAC

WUHAN :

ATGTTCGTGTTCCTGGTGCTGCTGCCCCTGGTGAGCAGCCAGTGCGTGAACCTGACCACC :

NOW YOU TELL ME JUST WHAT THESE TWO SEQUENCES HAVE TO DO WITH EACH OTHER ! THEY ARE TOTALLY DIFFERENT, PFIZER BOLDLY LIED WHEN THEY SAID THEY HAD USED THE WUHAN SPIKE SEQUENCE FOR THEIR MRNA VAX !

So now : the next Q is : what the hell did pfizer and the rest of them thugs put itnto their vaxes ?

We shall answer that Q in the next chapter coming up, but I can anticipate the answer here : the pfizer S protein sequence is a random lab-made concoction of their own, bearing high similarity with S sequences in known beta-subgroup coronaviruses (which all feature S).

But, fake-S aside, there are more dangerous ingredients in the pfizer vax.



Track-and tracing by way of nanotech in the vaccines :

" Pfizer/BioNTech is also inserting an ingredient derived from a marine invertebrate, mNeonGreen, into its vaccine. The ingredient has bioluminescent qualities, making it attractive for medical imaging purposes, but it is unclear why an injected vaccine would need to have that quality. mNeonGreen has unknown antigenicity." : https://www.stoppfizer.org/

(point X).

The authors, Wodarg and Yeadon, do not source their statement, but I found it confirmed here :

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7733605/

The official list of ingredients for the pfizer covid vax does not feature

mNeonGreen - Pfizer has published an incomplete list !! :

https://www.fda.gov/media/144414/download

" WHAT ARE THE INGREDIENTS IN THE PFIZER-BIONTECH COVID-19 VACCINE?The Pfizer-BioNTech COVID-19 Vaccine includes the following ingredients: mRNA, lipids ((4-hydroxybutyl)azanediyl) bis(hexane-6,1-diyl)bis(2-hexyldecanoate), 2 [(polyethylene glycol)-2000]-N,N-ditetradecylacetamide, 1,2-Distearoyl-sn-glycero-3-phosphocholine, and cholesterol), potassium chloride, monobasic potassium phosphate, sodium chloride, dibasic sodium phosphate dihydrate, and sucrose" ;

https://en.wikipedia.org/wiki/ALC-0315

https://en.wikipedia.org/wiki/Pfizer%E2%80%93BioNTech_COVID-19_vaccine

WHY HAS PFIZER HUSHED UP MNEONGREEN SO FAR ?

https://en.wikipedia.org/wiki/Lancelet#Fluorescent_mNeonGreen

" The yellow fluorescent protein from Branchiostoma lanceolatum exhibits unusually high quantum yield (~0.95).[45] It has been engineered into a monomeric green fluorescent protein known as mNeonGreen, which is the brightest known monomeric green or yellow fluorescent protein."

https://www.fpbase.org/protein/mneongreen/

https://www.molbiolcell.org/doi/10.1091/mbc.e16-01-0063

" These results identify ideal fluorescent proteins for imaging in vivo in C. elegans embryos and suggest good candidate fluorescent proteins to test in other animal model systems for in vivo imaging experiments." :

https://en.wikipedia.org/wiki/Bioluminescence_imaging

https://www.nature.com/articles/nmeth.2413

Excerpts :

mNeonGreen is the brightest monomeric green or yellow fluorescent protein yet described to our knowledge, performs exceptionally well as a fusion tag for traditional imaging as well as stochastic single-molecule superresolution imaging and is an excellent fluorescence resonance energy transfer (FRET) acceptor for the newest cyan fluorescent proteins.

Shaner et al. (2013)

... as it has so little sequence identity in common with other frequently used fluorescent proteins, mNeonGreen will be an attractive target for antibody development and should be amenable to orthogonal immunoprecipitation experiments along with jellyfish-derived and coral-derived fluorescent proteins.

Shaner et al. (2013)

IN BRIEF, THE REAL PURPOSE OF THE PFIZER VAX IS TO TURN PEOPLE INTO BIOLUMINESCENT GMOs, SO THEY MAY BE CONTROLLED ON THE INSIDE VIA IMAGING, AND NONVACCINATED PEOPLE MAY IMMEDIATELY BE DETECTED AND DISCRIMINATED AGAINST.

SURVIVORS OF THE PFIZER VACCINE WILL LITERALLY GLOW IN THE DARK AND THE SHADE FOR THE REST OF THEIR LIVES, TRACKED AND TRACED AND FOLLOWED AT WILL BY PIG PHARM 24/7 !!!

THIS ALLEGED COVID VACCINE HAS NOTHING WHATSOEVER TO DO WITH THE NONEXISTENT VIRUS SARS COV 2 AND ITS FICTIONAL COVID DISEASE - IT IS ALL ABOUT TRANSHUMANIZING THE MASSES INTO TRANSGENIC GMOS WHO WILL HAVE NOWHERE LEFT TO HIDE AND NO PRIVACY AND NO FREEDOM LEFT !!!

https://www.nytimes.com/2021/02/04/travel/coronavirus-vaccine-passports.html?action=click&module=Top%20Stories&pgtype=Homepage

They care so much who has it or not, because first, for biz purposes, they want to sell vaxes to everyone ; secondly, they want to track trace and control everyone 24/7 ; and third, because once the mRNA vax principle sinks in, next time it´s going to be a vax with a nanochip for remote controlling everyone´s brains : they have already developed such chips for disabled people. They call this nazi horror, "transhumanism". hitler´s euthanasia program and mengele´s experiments pale in comparison.

"COVID" VACCINES KILL :

https://vaccineimpact.com/2021/4576-dead-199213-injuries-european-database-of-adverse-drug-reactions-for-covid-19-vaccines/

https://vaccineimpact.com/

https://healthimpactnews.com/about-health-impact-news/

https://vaccinedeaths.com/#

https://www.hindustantimes.com/world-news/norway-23-people-die-within-days-of-getting-first-covid-19-vaccine-dose-101610804880470.html

https://www.corriere.it/.../coronavirus-grave-reazione...

https://www.corriere.it/cronache/21_gennaio_06/genova-anziana-rsa-muore-emorragia-cerebrale-vaccino-covid-regione-momento-nessun-nesso-b31d6f44-5011-11eb-9028-76598b615ecf.shtml

https://www.blitzquotidiano.it/cronaca-europa/sonia-acevedo-infermiera-morta-vaccino-3242511/

https://www.secondopianonews.it/news/cronaca/2021/01/27/un-altro-infermiere-muore-nel-sonno-infarto-aveva-fatto-la-seconda-dose-di-vaccino.html?fbclid=IwAR281NFdhPxBPeXfSgoAnKRrgCJ3r4zwA7lN5gQ7-z_clTim7NQ03PNAjOg

https://www.youtube.com/watch?v=H2Is21lA5RA

https://nursingnews.in/netherlands-87000-healthcare-workers-denied-covid-19-vaccine/

https://www.nytimes.com/live/2021/04/07/world/covid-vaccine-coronavirus-cases#astrazeneca-blood-clots

https://www.fda.gov/media/144413/download

" Revised : 12/20207 Adverse ReactionsAdverse reactions following the Pfizer-BioNTech C O VID-19 Vaccine that have been reported in clinical trials include injection site pain, fatigue, headache, muscle pain, chills, joint pain, fever, injection site swelling, injection site redness, nausea, malaise, and lymphadenopathy (see Full EUA Prescribing Information). Severe allergic reactions have been reported following the Pfizer-BioNTech C O VID-19 Vaccine during mass vaccination outside of clinical trials. Additional adverse reactions, some of which may be serious, may become apparent with more widespread use of the Pfizer-BioNTech COVID-19 Vaccine"

https://thevaccinereaction.org/

https://thevaccinereaction.org/2021/03/healthy-mom-39-in-utah-dies-of-organ-failure-four-days-after-moderna-covid-vaccination/

https://thevaccinereaction.org/2021/03/cdc-reports-1637-deaths-following-covid-19-vaccinations/

https://theconversation.com/how-mrna-vaccines-from-pfizer-and-moderna-work-why-theyre-a-breakthrough-and-why-they-need-to-be-kept-so-cold-150238

https://la.indymedia.org/news/2020/11/299955.php

http://www.lavocedellevoci.it/2020/05/17/microchip-per-tutti-la-nuova-democrazia-di-bill-gates-c/

https://oresundstartups.com/biohax-international-teams-up-with-london-based-icon-capital-reverse/

https://www.theguardian.com/technology/2019/nov/08/the-rise-of-microchipping-are-we-ready-for-technology-to-get-under-the-skin

http://www.iskrae.eu/piano-usa-controllo-militarizzato-della-popolazione/

https://www.sourcewatch.org/index.php/American_Medical_Association

https://www.bibliotecapleyades.net/sociopolitica/esp_sociopol_brotherhood05.htm

https://www.globalresearch.ca/chief-science-officer-pfizer-says-second-wave-faked-false-positive-covid-tests-pandemic-over/5724753

https://hubpages.com/politics/Pfizer-Chief-Science-Officer-Second-Wave-Based-on-Fake-Data-of-False-Positives-for-New-Cases-Pandemic-is-Over

https://www.youtube.com/watch?v=KCVLcNJnqck

https://www.abc.net.au/news/2020-12-13/coronavirus-covid-19-vaccines-russia-china-pfizer-borders-travel/12969604

pfizer´s massmurderers are profiting obscenely from vax sales and the killing of tens of thusands worldwide and injuring of hundreds of thousands worldwide:

https://www.openvaers.com/covid-data

(updates on vax deaths totals in the US + injuries)

https://www.globalresearch.ca/3964-dead-162610-injuries-european-database-adverse-drug-reactions-covid-19-vaccines/5740942

https://www.nytimes.com/2021/05/04/business/pfizer-covid-vaccine-profits.html?action=click&module=Well&pgtype=Homepage&section=Business

This last article fails to mention who the chief owners of pfizer´s stock are : globalist usurers and criminals against humanity fink lawrence and kapito robert of blackrock investement fund : https://www.marketscreener.com/quote/stock/PFIZER-INC-4821/company/

Shareholders Name Equities %

The Vanguard Group, Inc. 423,369,726 7.59% SSgA Funds Management, Inc. 279,581,111 5.01% Capital Research & Management Co. (World Investors) 266,647,618 4.78% Wellington Management Co. LLP 246,491,974 4.42% Capital Research & Management Co. 142,320,700 2.55% BlackRock Fund Advisors 128,734,240 2.31% Geode Capital Management LLC 90,448,809 1.62% Northern Trust Investments, Inc.(Investment Management) 66,718,775 1.20% Norges Bank Investment Management 60,296,992 1.08% State Farm Investment Management Corp. 56,536,168 1.01% Note that blackrock also owns vanguard, so their combined pfizer stock share is by far the largest : follow the money and you´ll discover those chiefly responsible for orchestrating the convid scam : fink lawrence and kapito robert.



Truth & Love on youtube 1.12.2021 :

Authorities forced to admit SarsCov2 (‘Covid-19’) does not exist https://www.brighteon.com/b530cbc6-a29a-4d50-bdc9-cd61213edec2 Public Health England admits using fake virus material to evaluate “COVID-19” tests, the gold standard is not isolated virus, and more Public Health England admits using fake virus material to evaluate “COVID-19” tests, the gold standard is not isolated virus, and more – Fluoride Free Peel Dr James Lyons Weiler Discusses Vaccines, Testing, and Damage from Response https://youtube.com/playlist?list=PL-UjFEqVPvdh_mAj0eE5SNai_8M2PY-Ev https://www.brighteon.com/9c410a23-e31c-41cf-9093-c510677bfc7c Biological Mechanisms of Vaccine Injury. https://youtu.be/xVDCgBQRQtI MORE HORRIFIC ADVERSE EVENTS: Are The Vaccines To Blame? #NoForcedMeds #MedicalTyranny https://www.brighteon.com/9294ffca-db62-4762-b7c7-9dd2c25be744 PROF DOLORES CAHILL: WHY PEOPLE WILL START DYING A FEW MONTHS AFTER THE FIRST MRNA VACCINATIONS https://www.brighteon.com/bf17debe-7940-46af-844a-0b3725c7948a BRAVE Reporter Goes OffScript Interviewing Doctor in BC Canada https://www.brighteon.com/7d6d4616-be9e-42c9-b661-b7beb651410d POLICE OFFICER CHRIS SAVAGE BLOWS LID ON VACCINE CRIMES https://www.brighteon.com/ea316b8b-fbbb-4f2b-9baf-7ac777f13807 How drug companies have repeatedly concealed important information about the risks of their medications? https://www.brighteon.com/941bb8de-3339-46a6-8bd7-1e398a0bfd44 70

Pig pharm through its sold-out politician scum, fills their monopolized MSM with fake videos of fake vaccinations of prominents, or fake covid patients allegedly on the brink of death. Let us debunk a few examples :

https://edition.cnn.com/videos/health/2020/12/21/joe-biden-receive-coronavirus-vaccine-vpx.cnn

biden vax

https://www.youtube.com/watch?v=VHCQ3cM02DQ

this is a blatant fakery :

1. the camera is at an angle that does not enable us to see the actual jab and the jabbed skin area

2. when the alleged nurse allegedly fills the syringe with the alleged vaccine, we see nothing because it all happens behind a red box obstructing our view

3. when she finally lifts the alleged vial, we have no way to see what it contains and whether or not she really is filling the syringe with its content

4. when she finally appears to hit the skin, we see nothing both because of camera angle and the tv banner covering the area : it´s a deliberate timing of putting up that caption just before the jab so we see nothing

5. biden doesn´t show the least reaction to getting jabbed : no pain, not the slightest wincing, nothing at all : nothing happened

6. usually, a droplet of blood comes pouring out the hole after a shot, but tha camera angle allows us to see nothing at all here

7. BUT THE CLEAREST EVIDENCE OF THIS BEING A FAKE SHOW COMES RIGHT AFTER THE INJECTION : WHAT A PROFESSIONAL NURSE WOULD DO AFTER INJECTING IS SWAB THE SKIN SITE WITH ALCOHOL AGAIN IN ORDER TO WIPE OFF THE BLOOD. OF COURSE THERE MIGHT BE CASES OF NO BLEEDING, BUT WE ARE NOT ALLOWED TO SEE THE JAB SITE AT ALL SO IT´S A JOKE IT PROVES NOTHING IT´S HIGHLY SUSPICIOUS AND FAKE. WATCH A REAL INJECTION, PROFESSIONALLY PERFORMED, HERE, AND NOTICE HOW EASY IT WOULD HAVE BEEN TO SHOOT THE SCENE CLOSE-UP AT THE RIGHT CAMERA ANGLE SO WE WOULD HAVE SEEN THE WHOLE ACTION :

https://www.google.com/search?client=firefox-b-d&q=how+to+perform+an+injection+videos#kpvalbx=_dyHhX8eaB9K3kwXcgZWgDg16

https://www.youtube.com/watch?v=2riVIOFQwCk

biden second dose

This vid proves nothing - only that it´s a phony show : 1. we do not see what the alleged nurse puts into the syringe - if he fills it at all 2. at 0´13´´, decisive jabbing moment, the vid goes out of focus for a sec : it can only be deliberate, in order to hide that biden isn´t getting jabbed at all

3. biden doesn´t show the least reaction to getting jabbed : no pain, not the slightest wincing, nothing at all : nothing happened

4. see here for comparison, how easy it would have been to place the camera at an angle and zoom position enabling the viewer to watch the proceedings in full detail up close : https://www.google.com/search?client=firefox-b-d&q=how+to+perform+an+injection+videos#kpvalbx=_dyHhX8eaB9K3kwXcgZWgDg16

https://video.corriere.it/esteri/covid-usa-fauci-si-sottopone-vaccino-diretta-tv/54f76700-4475-11eb-850e-8c688b971ab0

https://www.youtube.com/watch?v=aEx2g5G57KE

This is such a blatant hoax : he didn´t receive any injection at all and here´s y :

- first of all, the alleged nurse pops up out of nowhere : the syringe appears to already have been filled before the show, so we do not get to see with what content : whether or not that was moderna vaccine, is totally unverifiable ;

- 2. when was that syringe filled ? when performing a vaccination, or a medical injection in general, u don´t fill a syringe and then leave it out there on the table for ages before injecting, as the needle might get contaminated ;

- 3. falsie does not appear to wince even a slight bit - no reaction to jab pain at all - just like biden : impossible - the frontal cam angle and distance from injection site do NOT allow us to clearly see whether or not the needle actually pentrates his arm ;

- 4. AFTER AN INJECTION, A PROFESSIONAL NURSE WOULD SWAB THE INJECTION AREA WITH ALCOHOL AGAIN, BECUASE IN MOST CASES, THE HOLE WOULD BLEED A BIT AND ONE WOULD WANT TO WIPE THE BLOOD OFF BEFORE APPLYING THE PATCH : NONE OF THESE PHONY PIGS EVER SEEMS TO BLEED AFTER THE JAB : NOT BIDEN IN HIS OWN VAX PUBLICITY STUNT, NOR FALSIE...

- 5. notice how as falsie gets up to leave, the alleged nurse behind him desperately tries to attract his attention so she may hand him the paperwork - but he forgets to mind her - script too long for his limited acting skills...Only just before exiting the stage, does the alleged nurse finally manage to perform that last movie frame.

SUMMING IT ALL UP : THIS IS A TOTALLY UNVERIFIABLE PUB STUNT ; AND WE ARE ALLOWED TO STATE, IT IS MOST LIKELY A FAKERY, AS BLOOD WIPING WAS NOT PERFORMED BEFORE APPLYING THE PLASTER. THE CAM ANGLE AND DISTANCE ARE SUCH, THAT THE VERY ACT OF INJECTING IS TOTALLY UNVERIFIABLE : WATCH IN THE FOLLWONG VID, HOW EASY IT WOULDABEEN TO DISPEL DOUBT BY FILMING AT THE RIGHT ANGLE AND CLOSE-UP : https://www.google.com/search?client=firefox-b-d&q=how+to+perform+an+injection+videos#kpvalbx=_dyHhX8eaB9K3kwXcgZWgDg16

https://www.youtube.com/watch?v=aGBMlH-k8bA



https://www.youtube.com/watch?v=bKWWxRc0XsE

totally fake staged vid :

1. first alleged patient speaks in perfectly clear voice wihout coughing : impossible for pneumonia patients

2. first nurse touches first patient without gloves

3. if this really was a covid case, she´d be in isolation ward : no cameramen would be allowed in

4. second nurse soooo overwhelmed with overwork that she has time for MSM interviews !!

5. look at 1´32´´ how most ambulances are completely idle in their parking lots !!

6. notice at 1´50´´ how the spokesman isn´t wearing a mask while trumpeting his press

conference !!!

THIS VID IS CRIMINAL STAGED FAKE PROPAGANDA FOR A SCAMDEMIC FOR PROFIT AND RENAZIFICATION : EVERYONE INVOLVED IN THIS HOAX MUST BE IMMEDIATELY ARRESTED TRIED AND HANGED ON SEVERAL COUNTS OF CRIMES AGAINST HUMANITY !!!

Who is guilty of posting this pharmanazi fraud of a nowthisnews vid :

https://www.youtube.com/watch?v=nX4d2mxwCS8&lc=UgzvLYvN0MiSQP9a_EJ4AaABAg.9Fz7yEEckrn9G1MZx9nJNt

where this- ludicrous- crisis- actress- feigns- "covid",- yet- talks- flawlessly- for- nearly- 4- minutes- straight-, while- allegedly- dying- of- terminal- pneumonia,- looking- plump- healthy- lively- and- rosy-cheeked,- and- fitted with- gauges- behind- her- that- read- zero- !!!- :

1. lively plump rosy-cheeked on brink of death : impossible. She is perfectly healthy and able to talk lively and clearly, without any coughing or throat clearing : therefore she has no pneumonia and no fever and nothing. Therefore the pink cheeks may only indicate good health and not febrile state.

2. talking in clear tone of voice for 4 minutes straight while with terminal pneumonia : impossible

3. her eyes are constantly moving left and right - typical of someone reading off a script on teleprompter or cue card

4. gauges behind her read zero

5. if the tubes in her nose are a cannula, how do we know the device they are supposedly attached to are on ? Why are we not shown such device ? Backgound noise means nothing, as it can be overdubbed during postproduction, and what we hear in the vid is NOT cannula device noise, as the vid´s has a much lower pitch and dirtier sound : compare it to the real thing here :

https://www.youtube.com/watch?v=_rTq99Y8T_w

from 3´12´´ on

5. she appears to be crying, but where are her tears ?

6. no verifiable detail given either in the vid or by the newsfaking posters : name and address of her alleged hospital, name of doc in charge of her, nothing at all

7. this fake vid clearly wasn´t self-shot on a smartphone - it´s a professional cam and cameraman doing the shooting, so how come he was allowed into a supposed ICU isolation ward ? To prevent the propagation of droplets, patients on nasal cannulas are fitted with either oxygen masks or surgical masks : she is not, so how is the cameraman being protected from her droplets ? :

https://www.youtube.com/watch?v=j5uiY4m3s_8

3´35´´ on. She could have talked just as well with a surgical mask on !

Never saw a more blatant fakery in my whole life !

Well, here are the newsfakers who posted such fraud on youtube :

https://en.wikipedia.org/wiki/Kenneth_Lerer

lerer is co-founder of corporate fake news outlet huffington post, alongside another nowthisnews founder, eric hippeau.

hippeau is a venture capitalist and banking usurer, of those who finance yahoo among other fake news outlets.

Former channel4 news head of digital jon laurence joined as deputy editor in January 2018 :

another corporate newsfaker by trade :

https://en.wikipedia.org/wiki/NowThis_News

So these are the men and the monies behind nowthisnews...that nuremberg rope is awaiting them all.

In 2015, nowthisnews raised over 16 million bucks from venture capitalists - exactly the type of pigs interested in spreading fake news for a profit.

No wonder such capitalnazi pigs and profiteers would post fakeries like this one.

pharmanazi terrorists slated for prosecution : lerer kenneth ; hippeau eric ; laurence jon ; the crisis actress in the vid ; anybody else who collaborated in this con-vid scam ; bill and melinda gates, lawrence fink, robert kapito and the rest of them globalist usurers and pig pharm owners, for orchestrating it all.

For my French fellow Freedom Fighters :

https://www.youtube.com/watch?v=owFo3As_KNI

Ce video est completement faux et criminel : j´ai regardé mieux à l´aide d´une bonne loupe :

IL N´Y A PAS DU TOUT D´AIGUILLE DANS CETTE SYRINGUE !! LA PRETENDUE INFIRMIÈRE NE FAIT QU´APPUYER LA SYRINGE SANS AIGUILLE ET PRESSER UN PEUX LA PEAU POUR DONNER LA FAUSSE IMPRESSION DE PIQURE QUI NE SE PASSE PAS DU TOUT !!!

REGARDEZ COMME CETTE ACTRICE CRIMINELLE APPUYE LA SYRINGE À CONTACTE AVEC LA PEAU - S´IL Y AVAIT AIGUILLE, ELLE SERAIT COMPLETEMENT PLONGÉE DANS LE BRAS - CE QUI NE SE FAIT JAMAIS : ON MET JUSTE LE BOUT DE L´AIGUILLE DEDANS :

https://www.youtube.com/watch?v=pfAhHZQpenM

1´56´´ et suivant.

NOTEZ COMME LE VIDEO EST HORS FOCUS, PAR RAPPORT AU LIEN DONNÉ : C´EST FAIT EXPRÈS POUR OCCULTER LES DETAILS.

C´EST POUR CA QUE PAS UNE GOUTTE DE SANG SORT DU TROU APRES - IL N´Y A PAS DE TROU !!! C´EST POUR CA QUE CE CRIMINEL NE MONTRE AUCUNE REACTION AU MOMENT DE LA PRETENDUE PIQURE - PARCE QUE IL N´Y A PAS DE PIQURE DU TOUT !!! IL N´Y A RIEN DANS LA SYRINGUE MEME, CETTE ACTRICE NE FAIT QU´ EN FAIRE SORTIR DE L´AIR.

JE DEMANDE L´IMMEDIATE ARRESTATION DE CASTEX ET DU GOUVERNEMENT ENTIER ET LA FIN DE CETTE FARCE TRAGIQUE ET PHARMANAZI DU FAUX

COVID !!!!!!!!!!!!!!!!

A GENOME-FUNCTION-ALTERING VACCINE AGAINST A NONEXISTENT VIRUS ?

THE CRIMINALS AGAINST HUMANITY WHO OWN THE VAX-PRODUCING PIG PHARM CORPORATIONS ARE THE SAME FOR ALL OF THEM, CHIEF AMONG THEM FINK LAWRENCE AND KAPITO ROBERT OF BLACKROCK INVESTMENT MANAGEMENT CORP. :

(be aware when reading the shareholders, the both fund vanguard and fund blackrock are owned by lawrence fink and robert kapito, thus the two portfolios combined give these 2 globalist usurers and criminals against humanity, a de facto majority stake in ALL major covid-vax manufacturers):

https://www.marketscreener.com/quote/stock/ASTRAZENECA-PLC-4000930/company/

Shareholders



Name Equities %

Wellington Management Co. LLP 68,525,329 5.22%

Capital Research & Management Co. (World Investors) 56,102,804 4.27%

BlackRock Investment Management (UK) Ltd. 54,582,684 4.16%

Investor AB (Investment Company) 51,587,810 3.93%

The Vanguard Group, Inc. 35,481,044 2.70%

Norges Bank Investment Management 31,096,000 2.37%

BlackRock Fund Advisors 24,659,956 1.88%

BlackRock Advisors (UK) Ltd. 16,806,080 1.28%

Fidelity Management & Research Co. LLC 15,122,879 1.15%

SSgA Funds Management, Inc. 13,957,455 1.06%



https://www.marketscreener.com/quote/stock/PFIZER-INC-4821/company/

Shareholders



Name Equities %

The Vanguard Group, Inc. 423,369,726 7.59%

SSgA Funds Management, Inc. 279,581,111 5.01%

Capital Research & Management Co. (World Investors) 266,647,618 4.78%

Wellington Management Co. LLP 246,491,974 4.42%

Capital Research & Management Co. 142,320,700 2.55%

BlackRock Fund Advisors 128,734,240 2.31%

Geode Capital Management LLC 90,448,809 1.62%

Northern Trust Investments, Inc.(Investment Management) 66,718,775 1.20%

Norges Bank Investment Management 60,296,992 1.08%

State Farm Investment Management Corp. 56,536,168 1.01%



https://www.marketscreener.com/quote/stock/MODERNA-INC-47437573/company/

Shareholders

Name Equities %

Flagship Pioneering 24,366,937 6.16%

Baillie Gifford & Co. 24,312,271 6.14%

Stéphane Bancel

23,120,688 5.84%

The Vanguard Group, Inc. 22,687,508 5.73%

Robert Langer

11,509,357 2.91%

Fidelity Management & Research Co. LLC 7,940,013 2.01%

BlackRock Fund Advisors 7,391,851 1.87%

SSgA Funds Management, Inc. 6,024,687 1.52%

Thélème Partners LLP 5,343,698 1.35%

Geode Capital Management LLC 3,571,240 0.90%



https://www.marketscreener.com/quote/stock/JOHNSON-JOHNSON-4832/company/

(this is the company behind the "janssen" covid vax) :

Shareholders



Name Equities %

The Vanguard Group, Inc. 227,946,104 8.67%

SSgA Funds Management, Inc. 143,989,480 5.48%

BlackRock Fund Advisors 61,981,054 2.36%

Geode Capital Management LLC 40,109,105 1.53%

Wellington Management Co. LLP 35,424,217 1.35%

State Farm Investment Management Corp. 34,574,792 1.32%

Northern Trust Investments, Inc.(Investment Management) 32,715,033 1.24%

Capital Research & Management Co. 32,520,000 1.24%

Massachusetts Financial Services Co. 28,268,538 1.08%

Norges Bank Investment Management 27,770,786 1.06%



https://www.marketscreener.com/quote/stock/NOVAVAX-INC-58256108/company/

Shareholders

Name Equities %

The Vanguard Group, Inc. 5,467,285 8.59%

RA Capital Management LP 3,788,564 5.95%

BlackRock Fund Advisors 1,750,679 2.75%

SSgA Funds Management, Inc. 1,726,182 2.71%

Fidelity Management & Research Co. LLC 1,558,569 2.45%

Franklin Advisers, Inc. 1,263,880 1.99%

Susquehanna Financial Group LLLP 1,239,947 1.95%

Capital Research & Management Co. (World Investors) 1,185,742 1.86%

Perceptive Advisors LLC 1,043,000 1.64%

Geode Capital Management LLC 958,309 1.51%



https://www.marketscreener.com/quote/stock/SINOPHARM-GROUP-CO-LTD-103501148/company/

NO "CHINESE" OWNERSHIP WHATSOEVER ! :

Shareholders



Name Equities %

Thornburg Investment Management, Inc. 64,013,100 4.77%

Invesco Advisers, Inc. 62,943,600 4.69%

The Vanguard Group, Inc. 40,874,870 3.05%

Lazard Asset Management LLC 40,367,843 3.01%

Nordea Investment Management AB (Denmark) 36,495,203 2.72%

Norges Bank Investment Management 31,689,893 2.36%

Dimensional Fund Advisors LP 26,335,423 1.96%

Hermes Investment Management Ltd. 25,279,200 1.88%

BlackRock Fund Advisors 24,325,600 1.81%

Swedbank Robur Fonder AB 23,549,745 1.76%



https://www.corriere.it/economia/aziende/21_marzo_01/lotta-contro-coronavirus-sette-vaccini-confronto-059eb4ac-7a11-11eb-b9cd-5eae78a2031e.shtml

There is no such thing as covid, as a sars cov 2 virus or any of its alleged variants : if you bear with me, I´ll explain to you the fake science behind such baseless propaganda allegations.

Don´t be afraid of science and math, I´ll make it simple for all to see the scam being passed off as science.

This is one of the very first pseudoscientific articles claiming to have identified a sars cov 2

variant :

https://www.nature.com/articles/s41586-020-2895-3

Let us break it down together and expose it as total fraud. If anything should still be unclear to you, ask me and I´ll do my damnest to simplify for you without detracting from serious scientific methodology.

Let us start reading : the abstract is telltale already :

"Here we engineered the spike D614G substitution in the USA-WA1/2020 SARS-CoV-2 strain" :

ENGINEERED ? Yes, engineered : the variant they are ranting about was not found in a natural sample - it was engineered, that is synthesized in a lab !! THERE IS NO SUCH VARIANT IN ANY ALLEGEDLY COVID-POSITIVE SAMPLE : IN ORDER TO BE ABLE TO CLAIM THAT THERE WAS A VARIANT, THESE FAKERS HAD TO ENGINEER ONE IN THEIR LAB - THE ALLEGED AVAILABILITY OF SOME 47 MILLION INFECTED SAMPLES WORLDWIDE

NOTWITHSTANDING !!!

Later we shall see in detail how they achieved that.

There is no such thing as a sars cov 2 virus or any of its alleged variants : it´s a hoax and a crime against humanity.

The authors of this scam study posing as science incredibly add :

" Together with clinical findings, our work underscores the importance of this variant in viral spread and its implications for vaccine efficacy and antibody therapy." :

THE IMPORTANCE OF AN ALLEGED NONEXISTENT VARIANT THAT THEY THEMSELVES HAVE ENGINEERED IN THE LAB BUT DOES NOT EXIST ANYWHERE IN ANY OF THE TENS OF MILLION OF SAMPLES FROM ALLEGED COVID PATIENTS WORLDWIDE !!! YOU WOULD THINK THEY COULD EASILY FIND LIVE VIRUS FEATURING THIS ALLEGED VARIANT IN ANY SAMPLE, BUT NO, THEY HAD TO ENGINEER IT - AND THEY INTEND TO USE IT FOR VAXES AND THERAPIES

TO BOOT !!! THIS IS UMPTEENTH PROOF THAT NEITHER THE ALLEGED SARS COV 2 VIRUS NOR ANY OF ITS ALLEGED VARIANTS NOR THE ALLEGED DISEASE COVID NOR THE PANDEMIC EXIST AT ALL !!!

https://www.stoppfizer.org/

From youtube, 3.29.2021 :



bc capone83

Good luck to anyone thinking of getting there vaccine. My dad had the Pfizer jab and died five days later of natural causes apparently. Media scum and government scum

3



tek merion

My most heartfelt condolences. View my vid "eagle" on my channel if u will

1



bc capone83

@tek merion thank you. Great video and hopefully the subservient zombies wake up before it's to late

2



bc capone83

My dad's name was Ashley Paul Barker and he was an actor if anyone wants to Google him. Funeral on Thursday so i have to stay strong. Good luck in these challenging times people. All the best

https://www.youtube.com/channel/UCP05q1gHsl7kSy1Og9cL7pQ

(bc capone83 youtube channel)

https://www.youtube.com/watch?v=6HlJl5CrTxo

(nurse with convulsions after moderna vax)

Umpteenth casualties of the vaccine Holocaust :

- this is the recent testimony (April 2021) of a daughter from B.C., Canada : " I saw my dad last Monday you know.. i drove out to his house.. he looked like a million bucks..he was going out for a power walk...it´s funny the universal timing of things. I said to him...dad are you really going to get the v on wed...he said yes.. i told him...please dad dont let anyone ever pressure you into doing something you dont want to do...i said i wouldnt touch it with a 10 foot pole...he said well i dont want to end up on a ventilator...meaning catching the bug...well look at him now!!! In the ICU...encephalitis ...2 strokes. Shingles. All came on after v....you tell me. No way in hell that is a coincidence..."

It was the pfizer vax - they all kill and injure.

- stu beast on youtube, April 17, 2021 :

" A member of my family, totally healthy, 32 years old, died 2 days after being vaccinated. You can have my place in line, I'm not taking it. "

- woman paralyzed 12 hrs after the pfizer vax !! : https://www.youtube.com/watch?v=SQTHh88jDM8

- From youtube, April 26, 2021 :

dempsey 95

"Same thing happened to a friend of mine after his second shot he´s spent a week in hospital and now 3 weeks later still can´t walk properly but they told him it's not the vaccine. This was an active man who has lost muscle and is weak now in only a month".

- From youtube, April 26, 2021 :

Bettie Lewis

" I've lost 2 friends both took Pfizer ".

- From youtube, April 26, 2021 :

deb smith

" i took the first dose on 25th of march 1030am then at 530pm i had chest pains starting in right moved to left side for 3 or 4 minutes. lower back pain. i am having crazy first time events since vaccine. i am not getting dose 2. my right hand went numb on and off for a over week. now my right shoulder muscle killing me the other day and yesterday my neck went out . first time in my life. "

- From youtube, April 27, 2021 :

GW :

"Two women in their sixties had strokes after receiving this vaccine. One died and the other is doing physical therapy to regain her balance."

- From youtube, April 27, 2021 :

Jessica Leung :

" My father in law experienced something similar, 10 hours after taking the first dose he collapsed on the floor, his legs were numb and one side of his arm was numb too, follow by shortness of breath. He refused to take the second dose."

ONE OF THE MANY DOCTORS DENYING THIS SCAMDEMIC SPEAKS OUT :

- From youtube, April 26, 2021 :

Troy Troy

" I've been in medicine for 30 years. I have NEVER seen such a politicized issue in medicine until now. Dr's and Nurses (in my hospital and state) are not allowed to report adverse reactions to covid vaccines, people tested for Influenza are ALWAYS negative and end up strangely enough positive for Covid. Zero annual flu??? of course, because there isn't any money in the annual flu. Scamdemic 2020/2021. Are we going to be believing this garbage in 2025...2030... Depends on the sheep. "

https://www.openvaers.com/covid-data

https://www.globalresearch.ca/3964-dead-162610-injuries-european-database-adverse-drug-reactions-covid-19-vaccines/5740942

https://healthimpactnews.com/2021/cdc-5888-dead-329021-injuries-from-covid-19-shots-more-than-previous-29-years-of-vaers-vaccine-deaths/

NO TO VAX MANDATES !!!!

https://www.nytimes.com/live/2021/04/29/world/covid-vaccine-coronavirus-cases

NO TO THE CRIMINALIZATION OF COVID DENIERS !!! THE REAL CRIMINALS AND TERRORISTS AND CONSPIRACY THEORISTS ARE THE COVID ASSERTERS !!!

https://www.nytimes.com/2021/04/28/world/europe/germany-coronavirus-deniers-surveillance.html?action=click&module=Top%20Stories&pgtype=Homepage

According to official data, vax compliance in Norway as of 9.23.2021, is 67% fully vaxed, 76,7% 1-dosers :

https://www.statista.com/statistics/1202074/share-of-population-vaccinated-covid-19-by-county-worldwide/

Which means that the soft approach in Norway has been so much more successful in brainwashing the populace as in Australia, where, according to same link, only 39.3% have been fully injected so far, with 60,4% 1-dosers - a total failure in comparison. That´s y criminal authorities are cracking down so brutally on dissent in Australia as opposed to easy-going Norway : because Aussies are way more intelligent and brave and are rejecting the "vax" against this archfake ghost in droves. Love and respect to you dear Aussies, shame on Norwegians for being such sheeple.

CHAPTER 11 : ALPHABET SOUP

Now : the alleged sequence of the mRNA in the pfizer "vaccine" has been published and here it is :

https://web.archive.org/web/20210105162941/https://mednet-communities.net/inn/db/media/docs/11889.doc

(wait for microsoft to open window and click open)

This is supposed to be, we are told, the messenger RNA containing the code for our cells to produce the spike protein of the alleged sars cov 2 virus, so that our system will then react by developing antibodies and immunity memory against it. So this sequence, this mRNA sequence in the pfizer vax, codes among other things, for the spike. I remind you that this vax is entirely lab-made, that the manufacturers never had the live virus to work with, they took the chinese sequence from a tweet back in January 2020, so they say, and without bothering to verify it in real life, made their vax based on that chinese databank registration via a tweet from an Aussie colleague !!! Let´s see if this spike sequence stands :



AACCΨGAC CACCAGAACA CAGCΨGCCΨC CAGCCΨACAC CAACAGCΨΨΨ 150

ACCAGAGGCG ΨGΨACΨACCC CGACAAGGΨG ΨΨCAGAΨCCA GCGΨGCΨGCA 200

CΨCΨACCCAG GACCΨGΨΨCC ΨGCCΨΨΨCΨΨ CAGCAACGΨG ACCΨGGΨΨCC 250

ACGCCAΨCCA CGΨGΨCCGGC ACCAAΨGGCA CCAAGAGAΨΨ CGACAACCCC 300

GΨGCΨGCCCΨ ΨCAACGACGG GGΨGΨACΨΨΨ GCCAGCACCG AGAAGΨCCAA 350

CAΨCAΨCAGA GGCΨGGAΨCΨ ΨCGGCACCAC ACΨGGACAGC AAGACCCAGA 400

GCCΨGCΨGAΨ CGΨGAACAAC GCCACCAACG ΨGGΨCAΨCAA AGΨGΨGCGAG 450

ΨΨCCAGΨΨCΨ GCAACGACCC CΨΨCCΨGGGC GΨCΨACΨACC ACAAGAACAA 500

CAAGAGCΨGG AΨGGAAAGCG AGΨΨCCGGGΨ GΨACAGCAGC GCCAACAACΨ 550

GCACCΨΨCGA GΨACGΨGΨCC CAGCCΨΨΨCC ΨGAΨGGACCΨ GGAAGGCAAG 600

CAGGGCAACΨ ΨCAAGAACCΨ GCGCGAGΨΨC GΨGΨΨΨAAGA ACAΨCGACGG 650

CΨACΨΨCAAG AΨCΨACAGCA AGCACACCCC ΨAΨCAACCΨC GΨGCGGGAΨC 700

ΨGCCΨCAGGG CΨΨCΨCΨGCΨ CΨGGAACCCC ΨGGΨGGAΨCΨ GCCCAΨCGGC 750

AΨCAACAΨCA CCCGGΨΨΨCA GACACΨGCΨG GCCCΨGCACA GAAGCΨACCΨ 800

GACACCΨGGC GAΨAGCAGCA GCGGAΨGGAC AGCΨGGΨGCC GCCGCΨΨACΨ 850

AΨGΨGGGCΨA CCΨGCAGCCΨ AGAACCΨΨCC ΨGCΨGAAGΨA CAACGAGAAC 900

GGCACCAΨCA CCGACGCCGΨ GGAΨΨGΨGCΨ CΨGGAΨCCΨC ΨGAGCGAGAC 950

AAAGΨGCACC CΨGAAGΨCCΨ ΨCACCGΨGGA AAAGGGCAΨC ΨACCAGACCA 1000

GCAACΨΨCCG GGΨGCAGCCC ACCGAAΨCCA ΨCGΨGCGGΨΨ CCCCAAΨAΨC 1050

ACCAAΨCΨGΨ GCCCCΨΨCGG CGAGGΨGΨΨC AAΨGCCACCA GAΨΨCGCCΨC 1100

ΨGΨGΨACGCC ΨGGAACCGGA AGCGGAΨCAG CAAΨΨGCGΨG GCCGACΨACΨ 1150

CCGΨGCΨGΨA CAACΨCCGCC AGCΨΨCAGCA CCΨΨCAAGΨG CΨACGGCGΨG 1200

ΨCCCCΨACCA AGCΨGAACGA CCΨGΨGCΨΨC ACAAACGΨGΨ ACGCCGACAG 1250

CΨΨCGΨGAΨC CGGGGAGAΨG AAGΨGCGGCA GAΨΨGCCCCΨ GGACAGACAG 1300

GCAAGAΨCGC CGACΨACAAC ΨACAAGCΨGC CCGACGACΨΨ CACCGGCΨGΨ 1350

GΨGAΨΨGCCΨ GGAACAGCAA CAACCΨGGAC ΨCCAAAGΨCG GCGGCAACΨA 1400

CAAΨΨACCΨG ΨACCGGCΨGΨ ΨCCGGAAGΨC CAAΨCΨGAAG CCCΨΨCGAGC 1450

GGGACAΨCΨC CACCGAGAΨC ΨAΨCAGGCCG GCAGCACCCC ΨΨGΨAACGGC 1500

GΨGGAAGGCΨ ΨCAACΨGCΨA CΨΨCCCACΨG CAGΨCCΨACG GCΨΨΨCAGCC 1550

CACAAAΨGGC GΨGGGCΨAΨC AGCCCΨACAG AGΨGGΨGGΨG CΨGAGCΨΨCG 1600

AACΨGCΨGCA ΨGCCCCΨGCC ACAGΨGΨGCG GCCCΨAAGAA AAGCACCAAΨ 1650

CΨCGΨGAAGA ACAAAΨGCGΨ GAACΨΨCAAC ΨΨCAACGGCC ΨGACCGGCAC 1700

CGGCGΨGCΨG ACAGAGAGCA ACAAGAAGΨΨ CCΨGCCAΨΨC CAGCAGΨΨΨG 1750

GCCGGGAΨAΨ CGCCGAΨACC ACAGACGCCG ΨΨAGAGAΨCC CCAGACACΨG 1800

GAAAΨCCΨGG ACAΨCACCCC ΨΨGCAGCΨΨC GGCGGAGΨGΨ CΨGΨGAΨCAC 1850

CCCΨGGCACC AACACCAGCA AΨCAGGΨGGC AGΨGCΨGΨAC CAGGACGΨGA 1900

ACΨGΨACCGA AGΨGCCCGΨG GCCAΨΨCACG CCGAΨCAGCΨ GACACCΨACA 1950

ΨGGCGGGΨGΨ ACΨCCACCGG CAGCAAΨGΨG ΨΨΨCAGACCA GAGCCGGCΨG 2000

ΨCΨGAΨCGGA GCCGAGCACG ΨGAACAAΨAG CΨACGAGΨGC GACAΨCCCCA 2050

ΨCGGCGCΨGG AAΨCΨGCGCC AGCΨACCAGA CACAGACAAA CAGCCCΨCGG 2100

AGAGCCAGAA GCGΨGGCCAG CCAGAGCAΨC AΨΨGCCΨACA CAAΨGΨCΨCΨ 2150

GGGCGCCGAG AACAGCGΨGG CCΨACΨCCAA CAACΨCΨAΨC GCΨAΨCCCCA 2200

CCAACΨΨCAC CAΨCAGCGΨG ACCACAGAGA ΨCCΨGCCΨGΨ GΨCCAΨGACC 2250

AAGACCAGCG ΨGGACΨGCAC CAΨGΨACAΨC ΨGCGGCGAΨΨ CCACCGAGΨG 2300

CΨCCAACCΨG CΨGCΨGCAGΨ ACGGCAGCΨΨ CΨGCACCCAG CΨGAAΨAGAG 2350

CCCΨGACAGG GAΨCGCCGΨG GAACAGGACA AGAACACCCA AGAGGΨGΨΨC 2400

GCCCAAGΨGA AGCAGAΨCΨA CAAGACCCCΨ CCΨAΨCAAGG ACΨΨCGGCGG 2450

CΨΨCAAΨΨΨC AGCCAGAΨΨC ΨGCCCGAΨCC ΨAGCAAGCCC AGCAAGCGGA 2500

GCΨΨCAΨCGA GGACCΨGCΨG ΨΨCAACAAAG ΨGACACΨGGC CGACGCCGGC 2550

ΨΨCAΨCAAGC AGΨAΨGGCGA ΨΨGΨCΨGGGC GACAΨΨGCCG CCAGGGAΨCΨ 2600

GAΨΨΨGCGCC CAGAAGΨΨΨA ACGGACΨGAC AGΨGCΨGCCΨ CCΨCΨGCΨGA 2650

CCGAΨGAGAΨ GAΨCGCCCAG ΨACACAΨCΨG CCCΨGCΨGGC CGGCACAAΨC 2700

ACAAGCGGCΨ GGACAΨΨΨGG AGCAGGCGCC GCΨCΨGCAGA ΨCCCCΨΨΨGC 2750

ΨAΨGCAGAΨG GCCΨACCGGΨ ΨCAACGGCAΨ CGGAGΨGACC CAGAAΨGΨGC 2800

ΨGΨACGAGAA CCAGAAGCΨG AΨCGCCAACC AGΨΨCAACAG CGCCAΨCGGC 2850

AAGAΨCCAGG ACAGCCΨGAG CAGCACAGCA AGCGCCCΨGG GAAAGCΨGCA 2900

GGACGΨGGΨC AACCAGAAΨG CCCAGGCACΨ GAACACCCΨG GΨCAAGCAGC 2950

ΨGΨCCΨCCAA CΨΨCGGCGCC AΨCAGCΨCΨG ΨGCΨGAACGA ΨAΨCCΨGAGC 3000

AGACΨGGACC CΨCCΨGAGGC CGAGGΨGCAG AΨCGACAGAC ΨGAΨCACAGG 3050

CAGACΨGCAG AGCCΨCCAGA CAΨACGΨGAC CCAGCAGCΨG AΨCAGAGCCG 3100

CCGAGAΨΨAG AGCCΨCΨGCC AAΨCΨGGCCG CCACCAAGAΨ GΨCΨGAGΨGΨ 3150

GΨGCΨGGGCC AGAGCAAGAG AGΨGGACΨΨΨ ΨGCGGCAAGG GCΨACCACCΨ 3200

GAΨGAGCΨΨC CCΨCAGΨCΨG CCCCΨCACGG CGΨGGΨGΨΨΨ CΨGCACGΨGA 3250

CAΨAΨGΨGCC CGCΨCAAGAG AAGAAΨΨΨCA CCACCGCΨCC AGCCAΨCΨGC 3300

CACGACGGCA AAGCCCACΨΨ ΨCCΨAGAGAA GGCGΨGΨΨCG ΨGΨCCAACGG 3350

CACCCAΨΨGG ΨΨCGΨGACAC AGCGGAACΨΨ CΨACGAGCCC CAGAΨCAΨCA 3400

CCACCGACAA CACCΨΨCGΨG ΨCΨGGCAACΨ GCGACGΨCGΨ GAΨCGGCAΨΨ 3450

GΨGAACAAΨA CCGΨGΨACGA CCCΨCΨGCAG CCCGAGCΨGG ACAGCΨΨCAA 3500

AGAGGAACΨG GACAAGΨACΨ ΨΨAAGAACCA CACAAGCCCC GACGΨGGACC 3550

ΨGGGCGAΨAΨ CAGCGGAAΨC AAΨGCCAGCG ΨCGΨGAACAΨ CCAGAAAGAG 3600

AΨCGACCGGC ΨGAACGAGGΨ GGCCAAGAAΨ CΨGAACGAGA GCCΨGAΨCGA 3650

CCΨGCAAGAA CΨGGGGAAGΨ ACGAGCAGΨA CAΨCAAGΨGG CCCΨGGΨACA 3700

ΨCΨGGCΨGGG CΨΨΨAΨCGCC GGACΨGAΨΨG CCAΨCGΨGAΨ GGΨCACAAΨC 3750

AΨGCΨGΨGΨΨ GCAΨGACCAG CΨGCΨGΨAGC ΨGCCΨGAAGG GCΨGΨΨGΨAG 3800

CΨGΨGGCAGC ΨGCΨGCAAGΨ ΨCGACGAGGA CGAΨΨCΨGAG CCCGΨGCΨGA 3850

AGGGCGΨGAA ACΨGCACΨAC ACAΨGAΨGA

Now this is supposed to be RNA, because coronaviruses are made of RNA. The manufacturers have replaced U (Uracil) with a concotion of their own, a variant called PSI, full name 1-methyl-3'-pseudouridylyl , because it penetrates the cell easier so they say, avoiding attack by our immune system :

https://caretdashcaret.com/2020/12/30/pseudouridylyl-not-pseudouridine/

But by doing this, they have altered the sequence of this alleged spike protein quite a bit ! How can it be said to be the spike any longer, after replacing Uracil with PSI ? Their formulas are

different !! :

https://www.google.com/search?client=firefox-b-d&q=uracil+chemical+structure

https://caretdashcaret.com/2020/12/30/pseudouridylyl-not-pseudouridine/

Therefore, even assuming that the alleged sars cov2 virus and its alleged spike protein existed for real, how would our bodies´ immunity memory and allegedly specific antibodies produced against this artificial, lab-made PSI version of the spike, be able to recognize natural spikes/sars cov2 viruses when attacked by the alleged virus, the real natural thing, which is supposed to have Uracil and not PSI ?? How can one possibly achieve specificity of immunity/antibodies by feeding our cells a different spike formula than that allegedly existing in real life ??? This pfizer "vax" has nothing to do with nonexistent viruses or their fake spikes - it is but an experiment in genetic reengineering/transhumanization of mankind. If it works for them, next they´ll inject with whatever physical or psychological instructions they come up with, and turn us all into GMO´s at the bilderberg´s and their mengeles´ behest and remote control : say no.

And : since, as we saw, this new chemical invention, PSI, replacing Uracil in the spike, is intended to facilitate mRNA access to our cells because of its enhanced ability to dodge or fool our antibodies - this means that, once our bodies have expressed the spike protein with PSI instead of U, our immune system as a result will be weakened for good, ot at least for as long as the vax remains effective !!! The exact opposite of the vax´s stated purpose.

At this point, one would assume that replacing PSI with the restored U throughout the sequence, would give us the original chinese spike sequence pfizer said they based their vax off of. So I replaced all PSI´s with U´s, and here´s what it looked like :

AACCUGACCACCAGAACACAGCUGCCUCCAGCCUACACCAACAGCUUUACCAGAGGCGUGUACUACCCCGACAAGGUGUUCAGAUCCAGCGUGCUGCACUCUACCCAGGACCUGUUCCUGCCUUUCUUCAGCAACGUGACCUGGUUCCACGCCAUCCACGUGUCCGGCACCAAUGGCACCAAGAGAUUCGACAACCCCGUGCUGCCCUUCAACGACGGGGUGUACUUUGCCAGCACCGAGAAGUCCAACAUCAUCAGAGGCUGGAUCUUCGGCACCACACUGGACAGCAAGACCCAGAGCCUGCUGAUCGUGAACAACGCCACCAACGUGGUCAUCAAAGUGUGCGAGUUCCAGUUCUGCAACGACCCCUUCCUGGGCGUCUACUACCACAAGAACAACAAGAGCUGGAUGGAAAGCGAGUUCCGGGUGUACAGCAGCGCCAACAACUGCACCUUCGAGUACGUGUCCCAGCCUUUCCUGAUGGACCUGGAAGGCAAGCAGGGCAACUUCAAGAACCUGCGCGAGUUCGUGUUUAAGAACAUCGACGGCUACUUCAAGAUCUACAGCAAGCACACCCCUAUCAACCUCGUGCGGGAUCUGCCUCAGGGCUUCUCUGCUCUGGAACCCCUGGUGGAUCUGCCCAUCGGCAUCAACAUCACCCGGUUUCAGACACUGCUGGCCCUGCACAGAAGCUACCUGACACCUGGCGAUAGCAGCAGCGGAUGGACAGCUGGUGCCGCCGCUUACUAUGUGGGCUACCUGCAGCCUAGAACCUUCCUGCUGAAGUACAACGAGAACGGCACCAUCACCGACGCCGUGGAUUGUGCUCUGGAUCCUCUGAGCGAGACAAAGUGCACCCUGAAGUCCUUCACCGUGGAAAAGGGCAUCUACCAGACCAGCAACUUCCGGGUGCAGCCCACCGAAUCCAUCGUGCGGUUCCCCAAUAUCACCAAUCUGUGCCCUUCGGCGAGGUGUUCAAUGCCACCAGAUUCGCCUCUGUGUACGCCUGGAACCGGAAGCGGAUCAGCAAUUGCGUGGCCGACUACUCCGUGCUGUACAACUCCGCCAGCUUCAGCACCUUCAAGUGCUACGGCGUGUCCCCUACCAAGCUGAACGACCUGUGCUUCACAAACGUGUACGCCGACAGCUUCGUGAUCCGGGGAGAUGAAGUGCGGCAGAUUGCCCCUGGACAGACAGGCAAGAUCGCCGACUACAACUACAAGCUGCCCGACGACUUCACCGGCUGUGUGAUUGCCUGGAACAGCAACAACCUGGACUCCAAAGUCGGCGGCAACUACAAUUACCUGUACCGGCUGUUCCGGAAGUCCAAUCUGAAGCCCUUCGAGCGGGACAUCUCCACCGAGAUCUAUCAGGCCGGCAGCACCCCUUGUAACGGCGUGGAAGGCUUCAACUGCUACUUCCCACUGCAGUCCUACGGCUUUCAGCCCACAAAUGGCGUGGGCUAUCAGCCCUACAGAGUGGUGGUGCUGAGCUUCGAACUGCUGCAUGCCCCUGCCACAGUGUGCGGCCCUAAGAAAAGCACCAAUCUCGUGAAGAACAAAUGCGUGAACUUCAACUUCAACGGCCUGACCGGCACCGGCGUGCUGACAGAGAGCAACAAGAAGUUCCUGCCAUUCCAGCAGUUUGGCCGGGAUAUCGCCGAUACCACAGACGCCGUUAGAGAUCCCCAGACACUGGAAAUCCUGGACAUCACCCCUUGCAGCUUCGGCGGAGUGUCUGUGAUCACCCCUGGCACCAACACCAGCAAUCAGGUGGCAGUGCUGUACCAGGACGUGAACUGUACCGAAGUGCCGUGGCCAUUCACGCCGAUCAGCUGACACCUACAUGGCGGGUGUACUCCACCGGCAGCAAUGUGUUUCAGACCAGAGCCGGCUGUCUGAUCGGAGCCGAGCACGUGAACAAUAGCUACGAGUGCGACAUCCCCAUCGGCGCUGGAAUCUGCGCCAGCUACCAGACACAGACAAACAGCCCUCGGAGAGCCAGAAGCGUGGCCAGCCAGAGCAUCAUUGCCUACACAAUGUCUCUGGGCGCCGAGAACAGCGUGGCCUACUCCAACAACUCUAUCGCUAUCCCCACCAACUUCACCAUCAGCGUGACCACAGAGAUCCUGCCUGUGUCCAUGACCAAGACCAGCGUGGACUGCACCAUGUACAUCUGCGGCGAUUCCACCGAGUGCUCCAACCUGCUGCUGCAGUACGGCAGCUUCUGCACCCAGCUGAAUAGAGCCCUGACAGGGAUCGCCGUGGAACAGGACAAGAACACCCAAGAGGUGUUCGCCCAAGUGAAGCAGAUCUACAAGACCCCUCCUAUCAAGGACUUCGGCGGCUUCAAUUUCAGCCAGAUUCUGCCCGAUCCUAGCAAGCCCAGCAAGCGGAGCUUCAUCGAGGACCUGCUGUUCAACAAAGUGACACUGGCCGACGCCGGCUUCAUCAAGCAGUAUGGCGAUUGUCUGGGCGACAUUGCCGCCAGGGAUCUGAUUUGCGCCCAGAAGUUUAACGGACUGACAGUGCUGCCUCCUCUGCUGACCGAUGAGAUGAUCGCCCAGUACACAUCUGCCCUGCUGGCCGGCACAAUCACAAGCGGCUGGACAUUUGGAGCAGGCGCCGCUCUGCAGAUCCCCUUUGCUAUGCAGAUGGCCUACCGGUUCAACGGCAUCGGAGUGACCCAGAAUGUGCUGUACGAGAACCAGAAGCUGAUCGCCAACCAGUUUCAACAGCGCCAUCGGCAAGAUCCAGGACAGCCUGAGCAGCACAGCAAGCGCCCUGGGAAAGCUGCAGGACGUGGUCAACCAGAAUGCCCAGGCACUGAACACCCUGGUCAAGCAGCUGUCCUCCAACUUCGGCGCCAUCAGCUCUGUGCUGAACGAUAUCCUGAGCAGACUGGACCCUCCUGAGGCCGAGUGCAGAUCGACAGACUGAUCACAGGCAGACUGCAGAGCCUCCAGACAUACGUGACCCAGCAGCUGAUCAGAGCCGCCGAGAUUAGAGCCUCUGCAAUCUGGCCGCCACCAAGAUGUCUGAGUGUGUGCUGGGCCAGAGCAAGAGAGTGGACUUUUGCGGCAAGGGCUACCACCUGAUGAGCUUCCCUCAGUCUGCCCCUCACGGCGUGGUGUUUCUGCACGUGACAUAUGUGCCCGCUCAAGAGAAGAAUUUCACCACCGCUCCAGCCAUCUGCCACGACGGCAAAGCCCACUUUCCUAGAGAAGGCGUGUUCGUGUCCAACGGCACCCAUUGGUUCGUGACACAGCGGAACUUCUACGAGCCCCAGAUCAUCACCACCGACAACACCUUCGUGUCUGGCAACUGCGACGUCGUGAUCGGCAUUGUGAACAAUACCGUGUACGACCCUCUGCAGCCCGAGCUGGACAGCUUCAAAGAGGAACUGGACAAGUACUUUAAGAACCACACAAGCCCCGACGUGGACCUGGGCGAUAUCAGCGGAAUCAAUGCCAGCGUCGUGAACAUCCAGAAAGAGAUCGACCGGCUGAACGAGGUGGCCAAGAAUCUGAACGAGAGCCUGAUCGACCUGCAAGAACUGGGGAAGUACGAGCAGUACAUCAAGUGGCCCUGGUACAUCUGGCUGGGCUUUAUCGCCGGACUGAUUGCCAUCGUGAUGGUCACAAUCAUGCUGUGUUGCAUGACCAGCUGCUGUAGCUGCCUGAAGGGCUGUUGUAGCUGUGGCAGCUGCUGCAAGUUCGACGAGGACGAUUCUGAGCCCGUGCUGAAGGGCGUGAAACUGCACUACACAUGAUGA

If you enter the above sequence into the blast search for betacoronaviruses, you get as a result scores of known beta coronas : which appears to imply, they all feature the same sequence for their spike protein !! So just what is unique/specific about such a sequence ? :

https://www.ncbi.nlm.nih.gov/sars-cov-2/

go to "explore the data" and click on "run blast"

https://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=Betacoronavirus

enter the above sequence for the pfizer spike protein

keep the default optimization for "highly similar sequences"; no need to fill any other box; click on "blast" at page bottom and this is what u get :

https://blast.ncbi.nlm.nih.gov/Blast.cgi

click on any of the first 4 results (any link in the column featuring "severe acute respiratory syndrome-related coronavirus"), and you´ll get a long list of beta coronaviruses both animal and human ! They all feature a highly similar spike sequence ! Nothing specific to this alleged, nonexistent sars cov 2 virus there !! :

https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=694009

Sequence 147 from Patent EP3001990

Severe acute respiratory syndrome-related coronavirus

863 863 32% 0.0 79.39% 2382 LQ338105.1

Select seq HC494680.1 Sequence 1313 from Patent WO2009022236

Severe acute respiratory syndrome-related coronavirus

863 863 32% 0.0 79.39% 2382 HC494680.1

Select seq HC187344.1 Sequence 1313 from Patent WO2009130588

Severe acute respiratory syndrome-related coronavirus

863 863 32% 0.0 79.39% 2382 HC187344.1

Select seq GM741413.1 Sequence 147 from Patent WO2008004992

Severe acute respiratory syndrome-related coronavirus

863 863 32% 0.0 79.39% 2382 GM741413.1



Whereas if u click on the "sequence from patent" column

https://blast.ncbi.nlm.nih.gov/Blast.cgi#alnHdr_1073814461 :

similarity shares range from 79% to 85% !

And none of this patent sequences refers to the alleged sars-cov-2 spike protein, but instead, to alleged spikes in the alleged 2003 sars virus ! :

https://www.ncbi.nlm.nih.gov/nucleotide/LQ338105.1?report=genbank&log$=nuclalign&blast_rank=1&RID=P1E4HWDN013

https://www.ncbi.nlm.nih.gov/nucleotide/HC494680.1?report=genbank&log$=nuclalign&blast_rank=2&RID=P1E4HWDN013

https://www.ncbi.nlm.nih.gov/nucleotide/HC187344.1?report=genbank&log$=nuclalign&blast_rank=3&RID=P1E4HWDN013

https://www.ncbi.nlm.nih.gov/nucleotide/GM741413.1?report=genbank&log$=nuclalign&blast_rank=4&RID=P1E4HWDN013

https://www.ncbi.nlm.nih.gov/Taxonomy/Browser/wwwtax.cgi?id=694009

The next step in my investigation, was to enter this U sequence into a professional genome search software, and see if the result was identity with the spike : so I went to the standard software for viral searches :

https://www.ncbi.nlm.nih.gov/labs/virus/vssi/#/blastresults?job_id=HW9MM9P1016&SeqType_s=Nucleotide

https://www.ncbi.nlm.nih.gov/labs/virus/vssi/#/

(click on "search by sequence")

and crosschecked by entering the U version of the alleged pfizer spike into their search. The results were astonishing :

I WAS EXPECTING HUNDREDS OF THOUSANDS OF HIGHLY SIMILAR OR IDENTICAL SEQUENCES BECAUSE AS MANY ARE SAID TO HAVE BEEN ISOLATED AROUND THE WORLD - INSTEAD, I ONLY TURNED UP 4 REPEAT 4 RESULTS !!! NONE OF THEM DIRECTLY REFERRED TO THE ALLEGED SARS COV 2 VIRUS OR ITS ALLEGED SPIKE PROTEIN ! ONLY ONE REFERRED TO A SEQUENCE PUBLISHED IN 2020, ALL OTHERS WERE SEQUENCES FROM BEFORE THE ALLEGED DISCOVERY OF THE VIRUS !! THE ONLY SIGNIFICANT IDENTITY (99%) WAS FOUND WITH A LAB-MADE STRAIN OF THE MEASLES VIRUS VACCINE, MODIFIED TO ACCOMODATE THE ALLEGED SPIKE PROTEIN SO AS TO ALLEGEDLY BECOME A BIVALENT VAX !!! :

MW090971

Mutant Measles morbillivirus strain MeVvac2-SARS2-S(H), complete genome (Hoerner,C., et al.)

Attributes

Nuc Completeness: complete

Strain: MeVvac2-SARS2-S(H)

Length: 19800

Mol Type: cRNA

Geo Location: Germany

https://www.ncbi.nlm.nih.gov/protein/1920122493

https://www.ncbi.nlm.nih.gov/nuccore/MW090971

https://www.biorxiv.org/content/10.1101/2020.07.11.198291v1.full

This is a very dangerous vaccine, cumulating the potential side effects of the measles vax with that of the "covid" vax ! :

"the SARS-CoV-2 vaccine development has to proceed with some caution because of the potential risk of immunopathogenesis observed in some animal models, such as antibody-dependent enhancement (ADE) and enhanced respiratory disease (ERD) which seem to correlate with a Th2-biased immune response."

" Interestingly, the switch of pathology after infection from a rather moderate pathogenesis into an acute, devastating disease can be triggered by vaccination of persistently infected cats and has been attributed to the induction of antibodies that mediate enhancement of the disease, a process called antibody-dependent enhancement (ADE). During COVID-19, ADE might be the cause of the severe cases currently observed. Some case reports indicate that severe disease appeared more frequently in patients with high SARS-CoV-2 immunoglobulin G (IgG) levels (27)."

" The codon-optimized gene encoding full-length SARS-CoV-2 Spike glycoprotein S of isolate Wuhan-Hu-1 (Genebank accession no. MN908947.1) in plasmids pMA-RQ-SARS2-S flanked with AatII/MluI and NheI/XhoI restriction sites was obtained by gene synthesis (Invitrogen Life Technology, Regensburg, Germany)." :

THE SCIENTISTS WHO WORKED ON THE PFIZER VAX NEVER HAD THE LIVE VIRUS - NO WONDER, AS NOBODY DOES BECAUSE IT DOES NOT EXIST - SO HOW COULD THEY POSSIBLY TEST TRIAL WHETHER OR NOT THEIR "VAX"

WORKED ? YOU NEED THE LIVE VIRUS FOR THAT, TO BE INOCULATED INTO TEST TRIAL CELL CULTURES AND ANIMALS AND SEE WHETHER OR NOT IT IS PATHOGENIC ! ALL OF THIS IS A MOCKERY OF SCIENCE !!!

I hope you´ve realized that the mRNA in the pfizer vax does NOT code for the alleged spike protein of the alleged sars cov 2 virus - because both do NOT exist at all.

The article does state the researchers took the spike sequence from a January 2020 chinese databank submission - but they never verified such a reported sequence with the live virus !!! :

https://www.ncbi.nlm.nih.gov/nuccore/MN908947.1

(wuhan sequencing, zhang et all., used by biorixv authors : this sequencing bears a date of Jan.20, 2020, but the submission date to the chinese CDC is from Jan.5 !!! : a few days for sequencing a novel virus since the alarm went off at the end of December 2019 !!!! That´s ridiculous in and for itself !!! Not only that, but there´s a warning that the first sequencing was replaced on Jan.14, 2020 with this one :

https://www.ncbi.nlm.nih.gov/nuccore/MN908947.2

So we have 3 different versions of this alleged chinese sequencing alone !!!) :

https://www.ncbi.nlm.nih.gov/nuccore/MN908947

(updated version thereof from March 2020).

Other crushing evidence that these mRNA vaxes have nothing to do with the alleged, nonexistent spike protein of the alleged, nonexistent sars cov 2 virus lies therein, that the spike sequence for the moderna vaccine is totally different than that for the pfizer vax !!!! :

https://www.the-scientist.com/news-opinion/scientists-reverse-engineer-mrna-sequence-of-moderna-vaccine-68640

https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Assemblies%20of%20putative%20SARS-CoV2-spike-encoding%20mRNA%20sequences%20for%20vaccines%20BNT-162b2%20and%20mRNA-1273.docx.pdf

I mean just compare the 2 at a glance : take the first line for instance :

pfizer : AACCTGACCACCAGAACACAGCT...CAAGGTGTT

moderna : AACCTGACCAACCCGGAACCCAG...CGACAAGGT

I highlighted the different parts : need I continue ? The 2 sequences are so substantially different that they cannot possibly be encoding for the same protein !!! These criminal fraudsters are just throwing in their "vaccine" mix random nucleotide sequences that have nothing to do with a never observed, never isolated virus. Also notice how the anonymous scientists who published these sequences hid the fact that pfizer at least, as we saw in the official WHO report, replaced U with PSI ; and these "scientists" mistakenly used T (which belongs to DNA) instead of U (the spike is supposed to be RNA and thus feature Uracil not Thymine) for their sequences !!! THIS IS NOTHING BUT LIES AND DISINFORMATION !!!

Pig pharm´s real purpose with these so-called " covid vaccines" is, on the one hand, to massmurder the elderly, weak, infirm, in a global-scale reedition of hitler´s euthanasia program (which BTW, was inspired by early-XX-century US eugenicists: https://en.wikipedia.org/wiki/Eugenics_in_the_United_States ), because clearly this artificial, lab-made concoction is being lethal to millions of immunocompromised humans ; on the other hand, to make huge profits for pig pharm ; and thirdly, to open up a Pandora box of experimenting with transhumanization, that is the genetic editing of mankind to turn us all into remote-controlled GMOs under pretext of wave after wave of fake pandemics.

CHAPTER 12 : (UN)TIMELY DEATHS ?

David Crowe, the foremost opinion leader in the fight against the con-vid hoax, has died of cancer reportedly, on July 12, 2020 :

https://mhfh.com/tribute/details/31155/David-CROWE/obituary.html

https://www.youtube.com/watch?v=yTmsQ60X-Uw

I am struck and deeply affected by his sudden demise. It reminds me of the sudden death of Nobel-prize winner biochemist Kary Mullis, inventor of PCR - against the use of which for diagnostics he strongly warned. He died on August 7, 2019, reportedly of pneumonia. Very convenient timing

for the pharmanazis - a mere few months before their global corona hoax would be launched.

David Crowe was 63.

I´ll just ask the Q : is regime terror causing cancer somehow, in these more visible freedom

fighters ?

Antivax, antibigpharm activist Brandy Vaughan was found dead in her home, at age 44, in December 2020 :

she had been in high spirits and healthy til the day before...

https://www.aimsib.org/2020/12/13/brandy-vaughan-decedee-en-quelques-heures/

https://learntherisk.org/

https://planetaryliberation.community/tag/why-was-brandy-vaughan-murdered/

Tanzanian president John Magufuli, a trained chemist and fierce downplayer of the covid delirium,

died a hitherto mysterious death at age 61, on 3.17.2021 :

https://en.wikipedia.org/wiki/John_Magufuli#Death

https://uncoverdc.com/2020/04/07/was-the-covid-19-test-meant-to-detect-a-virus/

https://bpa-pathology.com/covid19-pcr-tests-are-scientifically-meaningless/

https://foreignpolicynews.org/2020/07/25/covid-19-does-not-exist-the-global-elites-campaign-of-terror-against-humanity/

https://ecoterra.info/index.php/de/2048-kein-existenzbeweis-da-fuer-sars-cov-2-virus

https://telegra.ph/PCR-Ein-DNA-Test-wird-zum-Manipulationsinstrument-06-28

https://wissenschafftplus.de/uploads/article/wissenschafftplus-fehldeutung-virus-teil-2.pdf

https://theinfectiousmyth.com/book/CoronavirusPanic.pdf

https://geopolitiker.wordpress.com/2020/04/02/pcr-test-der-totale-unfug-impfstoffe-und-gut-geschmiert-christian-dorsten/



Geoffrey Callaghan on youtube, october 20, 2020 :

" If the Test works - Why the False positives? If the Masks work - Why the Six Feet? If the Six Feet work - Why the Masks? If all Three work - Why the Lockdown? If all Four work - Why the vaccine? If the Vaccine is Safe - Why the No Liability Clause? If SARS-CoV-2 exists - Why has it not been isolated? "

Glen Gordon on youtube, october 27, 2020 :

" This covid hoax is going to be the focus on this very crucial time in human history . The outcome of this giant hoax will be the direction we fall into . We have a window of time here to take down the government and stop not only this hoax but all of their corruption . We have the power and we have few choices if we want to survive this attack on humanity . They plan to force- vaccinate everyone except those in power and in those vaccines will be microchips and deadly poison ... If we don´t stand together as one race and stop them they will be making unlawful restrictions and paying the police to enforce laws that will violate all human rights and will be eligible for war crimes and crimes against humanity . This will be nothing short of Nazi Germany revisited . Nobody will be able to buy food, gas, or anything without the microchip , they will abolish all money and everything will have to be purchased by microchip , they will say it´s for our own safety and that will be the death of humanity if we let it get that far . We must stop them NOW , we can´t wait until the military knocks on our door to realize they are taking us to fema facilities which they have all over north america . They are set up to take those said to be covid-positive and for those that do not comply . [...]This is not a test people it´s now or never , we have a small window of time to stop them or it´s lights out for everyone"

https://www.abc.net.au/news/2020-12-13/coronavirus-covid-19-vaccines-russia-china-pfizer-borders-travel/12969604

https://www.nytimes.com/live/2021/04/02/world/covid-vaccine-coronavirus-cases?type=styln-live-updates&label=coronavirus%20updates&index=0&action=click&module=Spotlight&pgtype=Homepage#florida-vaccine-passport-desantis

https://www.nytimes.com/article/covid-vaccine-card.html?action=click&module=Top%20Stories&pgtype=Homepage

LET US AVOID COMPLACENCY UNTO THE LOBOTOMIZED MASSES : WE THE ENLIGHTENED MUST BECOME ENLIGHTENERS BY DAILY SABOTAGING INFILTRATING COUNTERSPAMMING AND COUNTERTROLLING THE MASSMEDIA SUCH AS THE COMMENT SECTIONS OF UTUBE´S PHARMANAZI PROPAGANDA VIDEOS WITH AT LEAST 300,000 VIEWS, OR IF NEWLY POSTED, AT LEAST 30,000 VIEWS A DAY, FOR THAT IS WHERE THE BATTLE FOR THE HEARTS AND MINDS IS LOST OR WON.

ALSO READ HERE THE UNABASHED DIRTY TRICKS MASS PSYCHOLOGISTS ON PIG PHARM´S PAYROLL ARE USING TO NUDGE PEOPLE INTO FRAUDULENT COVID MASS SCREENING :

https://www.nytimes.com/2021/04/02/health/coronavirus-testing-behavior-hesitancy.html?action=click&module=Science%20%20Technology&pgtype=Homepage

SUCH TACTICS ONLY CONFIRMS THAT THIS IS A TERRORIST PHARMANAZI PSYOP WITHOUT ANY MEDICAL GROUNDS WHATSOEVER !!!



A great youtube commentator posted this quote on November 19, 2020 :

" Vince Campbell

Charlie Ward- “I asked an Amish community leader why he had no covid cases and he replied, Because we have no television or social media.” "

Yet another great youtube commentator on Nov. 20,2020 :



K C

" Denmark have repelled their epidemic laws and lockdowns ( our coronavirus act ) due to it being unlawful and completely unsubstantiated. Portugal have dismissed the use of PCR testing to enforce quarantines due to its high inaccuracy and inability to test for a live virus. Denmark have stopped its enforcement of masks because there is no evidence to prove the value of wearing one . To imprison a whole healthy nation on conflated, inaccurate fraudulent data is irrational, just open your eyes and take a look around "

UN-common Sense AUS Nov.25, 2020 on youtube :

The spike is caused by imbeciles submitting to THE DNA HARVESTING PROCEDURE THAT IS A PCR TEST PCR TESTS ARE NOT I REPEAT NNOOOOOTTT DIAGNOSTIC TESTS all you fucken morons getting tested are what they are using to fabricate the numbers, they have convinced you fucken morons that it´s abnormal for elderly people (i.e. those older than 82 - the natural life expectancy in the west) so all you fuckwits think there is a massive surge in deaths from the invisible monster "covid" which is a provable hoax have you not noticed that all other causes of death have plummedted to below zero, there has also been ZERO REPORTED CASES OF THE SEASONAL FLU THIS YEAR, IT´S A FUCKING MIRACLE, THE COMMON COLD HAS BEEN FORCED INTO EXTINCTION BY AN IMAGINARY DISEASE THAT PROPAGATES ONLY THROUGH TV AND SPECIFICALLY VIA MAINSTREAM NEWS MEDIA, THIS MAKES THE MSM A SUPER SPREADER AND AS SUCH THEY MUST BE QUARANTEENED.

It is impossible to free fools from chains they revere - Voltaire.

Last quote from yoututbe´s comment sections, dec.14, 2020 :

False Positive

I asked a doctor when they think this virus will end. He said how should I know, I'm a doctor not a politician.

https://off-guardian.org/2021/04/17/open-letter-to-a-friend-who-tested-positive-and-should-have-known-better/

PRAISED BE ALL THOSE WHO ARE REFUSING THE JAB WORLDWIDE ! :

https://www.nytimes.com/2021/03/28/health/nursing-home-covid-19-vaccine.html?action=click&module=Top%20Stories&pgtype=Homepage

https://www.nytimes.com/2021/04/05/us/covid-vaccine-evangelicals.html?action=click&module=Top%20Stories&pgtype=Homepage

https://www.nytimes.com/2021/04/09/health/vaccine-mississippi-demand.html?action=click&module=Spotlight&pgtype=Homepage

PRAISED BE MISSISSIPPI, ALABAMA AND GEORGIA FOR REFUSING THE LETHAL INJECTION EN MASSE !!! : " In some parts of the country, that point may be here. In Mississippi, which opened vaccinations to all adults a month ago, 21 percent of the population is fully inoculated. In Alabama, the figure is 19 percent. In Georgia, home of the Centers for Disease Control and Prevention, only 20 percent of the population is fully vaccinated." https://www.nytimes.com/2021/04/21/us/politics/coronavirus-vaccine-rates.html?action=click&module=Top%20Stories&pgtype=Homepage

PRAISED BE THOSE WHO AWAKEN TO THE DANGER AFTER SUFFERING FROM THE FIRST SHOT !!! . " On top of that, Ms. Bloomfield said her members reported that as many as 15 percent of people in small towns were not showing up for their second shot. She attributed some of that to social media posts about side effects. “That doesn’t help us,” she said." : https://www.nytimes.com/2021/04/21/us/politics/coronavirus-vaccine-rates.html?action=click&module=Top%20Stories&pgtype=Homepage

AND HALF OF MANKIND IS ALSO REFUSING THE LETHAL INJECTION !!! :

https://covidtracker.fr/vaccintracker/

(scroll down to page bottom for official international data : and mind u, official data are likely inflated by lying pig pharm puppets ! )

FURTHERMORE, MILLIONS IN THE US AND WORLDWIDE ARE SKIPPING THE SECOND DOSE - AFTER FEELING SO SICK FROM THE FIRST ONE AND HEARING ABOUT SO MANY VAX MURDERS !!! :

https://www.nytimes.com/2021/04/25/business/covid-vaccines-second-doses.html?action=click&module=Top%20Stories&pgtype=Homepage

Because pig pharm thru all of its sellout politician scum and law enforcement dregs has utterly failed so far to convince the majority of mankind to take up the lethal injection, they are now getting more violent and overtly nazistic by raising the volume of msm mandatory-vax propaganda :

https://www.nytimes.com/2021/04/14/opinion/coronavirus-vaccinations-mandate.html?action=click&module=Opinion&pgtype=Homepage

Just read the terrorist tactics these pig pharmers are using against their own people : " Civic groups are conducting door-to-door visits, akin to a get-out-the-vote effort, in neighborhoods with low vaccination rates. In Alabama, Dr. Scott Harris, the state health officer, is trying to reach rural white residents, who are mistrustful of politicians and the news media. Dr. Harris is asking doctors to record cellphone videos, with a plea: “Please email them to your patients, saying, ‘This is why I think you ought to take the vaccine.’” https://www.nytimes.com/2021/04/21/us/politics/coronavirus-vaccine-rates.html?action=click&module=Top%20Stories&pgtype=Homepage

Pharmanazi terrorists on pig pharm´s payroll are waging a war against their own nations and all of humanity, most of whom is refusing the poison jab - and those pigs candidly admit it : " “If you think of this as a war,” said Michael Carney, the senior vice president for emerging issues at the U.S. Chamber of Commerce Foundation, “we’re about to enter the hand-to-hand combat phase of the war.” https://www.nytimes.com/2021/04/21/us/politics/coronavirus-vaccine-rates.html?action=click&module=Top%20Stories&pgtype=Homepage

Except for failing to prove after 14 months of incessant drumbeat, that the alleged sars cov 2 virus, the alleged covid disease and the alleged pandemic thereof be real...

Duck ´em all, RESIST AND REJECT THE VAX EVEN WHEN MANDATORY !!!

MASS CIVIL DISOBEDIENCE IS WHAT WE NEED !!!

https://twitter.com/davidrcrowe

https://drive.google.com/file/d/1S7xW72ahs7Guqo7JzzPFuI0P6wjg_j5r/view

(situation in Spain)

https://www.ukcolumn.org/article/covid-19-hoax

http://philosophers-stone.info/wp-content/uploads/2020/11/The-scam-has-been-confirmed-Dsalud-November-2020.pdf

https://www.dsalud.com/consejo-asesor/

https://in-this-together.com/covid-19-evidence-of-global-fraud/

https://in-this-together.com/

Would you take a vax manufactured by such criminals against humanity ? : https://www.theguardian.com/us-news/2021/jul/21/us-opioid-settlement-state-attorneys-general-johnson-and-johnson

https://www.fda.gov/media/144414/download pfizer vax ingredients and side effects : " Side effects that have been reported with the Pfizer-BioNTech COVID-19 Vaccine include: • severe allergic reactions • non-severe allergic reactions such as rash, itching, hives, or swelling of the face • myocarditis (inflammation of the heart muscle) • pericarditis (inflammation of the lining outside the heart) • injection site pain • tiredness • headache • muscle pain • chills • joint pain • fever • injection site swelling 4 Revised: 25 June 2021 • injection site redness • nausea • feeling unwell • swollen lymph nodes (lymphadenopathy) • diarrhea • vomiting • arm pain These may not be all the possible side effects of the Pfizer-BioNTech COVID-19 Vaccine. Serious and unexpected side effects may occur. Pfizer-BioNTech COVID-19 Vaccine is still being studied in clinical trials. " : WOULD U WANT TO RISK ALL THAT OVER A VIRUS NEVER EVEN PROVEN TO EXIST ???

illgates´ 10 commandments :

1. I AM THE COVID THY LORD

2. THOU SHALT HAVE NO OTHER DISEASE BEFORE ME

3. REMEMBER THE PCR TEST, TO KEEP IT HOLY

4. HONOUR THY FAUCI AND NO OTHER

5. THOU SHALT BE MURDERED

6. THOU SHALT BEAR FALSE WITNESS AGAINST THY NEIGHBOUR

7. THOU SHALT NOT HEAL

8. THOU SHALT NOT TRAVEL WITHOUT YOUR VAX PASSPORT

9. THOU SHALT NOT COVID YOUR NEIGHBOUR´S HOUSE

10. THOU SHALT NOT COVID YOUR NEIGHBOUR´S WIFE

...unless your name is nicole kidman, for some pigs are more equal than others and apparently immune to this ghost virus :

https://www.theguardian.com/world/2021/aug/19/hong-kong-reportedly-lets-nicole-kidman-skip-covid-quarantine



March 7, 2020 - November 10, 2021

TEK

Report this post as:

© 2000-2018 Los Angeles Independent Media Center. Unless otherwise stated by the author, all content is free for non-commercial reuse, reprint, and rebroadcast, on the net and elsewhere. Opinions are those of the contributors and are not necessarily endorsed by the Los Angeles Independent Media Center. Running sf-active v0.9.4 Disclaimer | Privacy